Recombinant Human YWHAQ Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : YWHAQ-4572H
Product Overview : YWHAQ MS Standard C13 and N15-labeled recombinant protein (NP_006817) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis. It contains in its 5' UTR a 6 bp tandem repeat sequence which is polymorphic, however, there is no correlation between the repeat number and the disease.
Molecular Mass : 27.8 kDa
AA Sequence : MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAENTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name YWHAQ tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta [ Homo sapiens (human) ]
Official Symbol YWHAQ
Synonyms YWHAQ; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide; 14-3-3 protein theta; 14 3 3; HS1; protein tau; 14-3-3 protein tau; 14-3-3 protein T-cell; 1C5; 14-3-3;
Gene ID 10971
mRNA Refseq NM_006826
Protein Refseq NP_006817
MIM 609009
UniProt ID P27348

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All YWHAQ Products

Required fields are marked with *

My Review for All YWHAQ Products

Required fields are marked with *

0
cart-icon
0
compare icon