Recombinant Human YY1 Protein, His-tagged
| Cat.No. : | YY1-630H |
| Product Overview : | Recombinant Human YY1 fused with His tag at C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1. |
| Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4. |
| Molecular Mass : | 12.6kD |
| AA Sequence : | MVTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGLEHHHHHH |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Gene Name | YY1 YY1 transcription factor [ Homo sapiens ] |
| Official Symbol | YY1 |
| Synonyms | YY1; YY1 transcription factor; transcriptional repressor protein YY1; DELTA; INO80 complex subunit S; INO80S; NF E1; UCRBP; Yin and Yang 1 protein; YIN YANG 1; YY-1; delta transcription factor; NF-E1; YIN-YANG-1; |
| Gene ID | 7528 |
| mRNA Refseq | NM_003403 |
| Protein Refseq | NP_003394 |
| MIM | 600013 |
| UniProt ID | P25490 |
| ◆ Recombinant Proteins | ||
| YY1-599H | Recombinant Human YY1, FLAG-tagged | +Inquiry |
| YY1-10272M | Recombinant Mouse YY1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| YY1-18688M | Recombinant Mouse YY1 Protein | +Inquiry |
| YY1-31565TH | Recombinant Human YY1 | +Inquiry |
| YY1-16H | Recombinant Human YY1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| YY1-228HCL | Recombinant Human YY1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YY1 Products
Required fields are marked with *
My Review for All YY1 Products
Required fields are marked with *
