Recombinant Human YY1 Protein, His-tagged

Cat.No. : YY1-630H
Product Overview : Recombinant Human YY1 fused with His tag at C-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.
Form : Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4.
Molecular Mass : 12.6kD
AA Sequence : MVTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGLEHHHHHH
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name YY1 YY1 transcription factor [ Homo sapiens ]
Official Symbol YY1
Synonyms YY1; YY1 transcription factor; transcriptional repressor protein YY1; DELTA; INO80 complex subunit S; INO80S; NF E1; UCRBP; Yin and Yang 1 protein; YIN YANG 1; YY-1; delta transcription factor; NF-E1; YIN-YANG-1;
Gene ID 7528
mRNA Refseq NM_003403
Protein Refseq NP_003394
MIM 600013
UniProt ID P25490

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All YY1 Products

Required fields are marked with *

My Review for All YY1 Products

Required fields are marked with *

0
cart-icon