"YY1" Related Products

Expand

Recombinant Human YY1 Protein, His-tagged

Cat.No. : YY1-630H
Product Overview : Recombinant Human YY1 fused with His tag at C-terminal was expressed in E. coli.
Description : YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.
Source : E. coli
Species : Human
Tag : His
Form : Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4.
Molecular Mass : 12.6kD
AA Sequence : MVTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGLEHHHHHH
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name : YY1 YY1 transcription factor [ Homo sapiens ]
Official Symbol : YY1
Synonyms : YY1; YY1 transcription factor; transcriptional repressor protein YY1; DELTA; INO80 complex subunit S; INO80S; NF E1; UCRBP; Yin and Yang 1 protein; YIN YANG 1; YY-1; delta transcription factor; NF-E1; YIN-YANG-1;
Gene ID : 7528
mRNA Refseq : NM_003403
Protein Refseq : NP_003394
MIM : 600013
UniProt ID : P25490

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.