Recombinant Human ZBTB17 protein(651-750 aa), C-His-tagged
Cat.No. : | ZBTB17-2844H |
Product Overview : | Recombinant Human ZBTB17 protein(Q13105)(651-750 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 651-750 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | GSEVSVVTVDDMVTLATEALAATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACDSCGDKFLDANSLAQHVRIHTAQALVMFQTD |
Gene Name | ZBTB17 zinc finger and BTB domain containing 17 [ Homo sapiens ] |
Official Symbol | ZBTB17 |
Synonyms | MIZ-1; ZNF60; ZNF151; pHZ-67 |
Gene ID | 7709 |
mRNA Refseq | NM_003443.2 |
Protein Refseq | NP_003434.2 |
MIM | 604084 |
UniProt ID | Q13105 |
◆ Recombinant Proteins | ||
ZBTB17-020H | Recombinant Human ZBTB17 Protein, His-tagged | +Inquiry |
ZBTB17-7964H | Recombinant Human ZBTB17, His-tagged | +Inquiry |
ZBTB17-5067R | Recombinant Rhesus Macaque ZBTB17 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZBTB17-678H | Recombinant Human ZBTB17 Protein, Myc/DDK-tagged | +Inquiry |
ZBTB17-5254R | Recombinant Rhesus monkey ZBTB17 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZBTB17-219HCL | Recombinant Human ZBTB17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZBTB17 Products
Required fields are marked with *
My Review for All ZBTB17 Products
Required fields are marked with *