Recombinant Human ZBTB17 protein(651-750 aa), C-His-tagged
| Cat.No. : | ZBTB17-2844H |
| Product Overview : | Recombinant Human ZBTB17 protein(Q13105)(651-750 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 651-750 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | GSEVSVVTVDDMVTLATEALAATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACDSCGDKFLDANSLAQHVRIHTAQALVMFQTD |
| Gene Name | ZBTB17 zinc finger and BTB domain containing 17 [ Homo sapiens ] |
| Official Symbol | ZBTB17 |
| Synonyms | MIZ-1; ZNF60; ZNF151; pHZ-67 |
| Gene ID | 7709 |
| mRNA Refseq | NM_003443.2 |
| Protein Refseq | NP_003434.2 |
| MIM | 604084 |
| UniProt ID | Q13105 |
| ◆ Recombinant Proteins | ||
| ZBTB17-4702C | Recombinant Chicken ZBTB17 | +Inquiry |
| ZBTB17-678H | Recombinant Human ZBTB17 Protein, Myc/DDK-tagged | +Inquiry |
| ZBTB17-5254R | Recombinant Rhesus monkey ZBTB17 Protein, His-tagged | +Inquiry |
| ZBTB17-01H | Recombinant Human ZBTB17 Protein, His-tagged | +Inquiry |
| ZBTB17-020H | Recombinant Human ZBTB17 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZBTB17-219HCL | Recombinant Human ZBTB17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZBTB17 Products
Required fields are marked with *
My Review for All ZBTB17 Products
Required fields are marked with *
