Recombinant Human ZBTB17 protein, His-tagged
| Cat.No. : | ZBTB17-3780H |
| Product Overview : | Recombinant Human ZBTB17 protein(454-803 aa), fused with His tag, was expressed in E.coli. |
| Availability | January 08, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 454-803 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | KFNQVGNLKAHLKIHIADGPLKCRECGKQFTTSGNLKRHLRIHSGEKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGDLSKHIIIHTGEKPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGIKILEPEEGSEVSVVTVDDMVTLATEALAATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACDSCGDKFLDANSLAQHVRIHTAQALVMFQTDADFYQQYGPGGTWPAGQVLQAGELVFRPRDGAEGQPALAETSPTAPECPPPAE |
| Purity : | 75%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ZBTB17 zinc finger and BTB domain containing 17 [ Homo sapiens ] |
| Official Symbol | ZBTB17 |
| Synonyms | MIZ-1; ZNF60; ZNF151; pHZ-67 |
| Gene ID | 7709 |
| mRNA Refseq | NM_003443.2 |
| Protein Refseq | NP_003434.2 |
| MIM | 604084 |
| UniProt ID | Q13105 |
| ◆ Recombinant Proteins | ||
| ZBTB17-5067R | Recombinant Rhesus Macaque ZBTB17 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ZBTB17-7964H | Recombinant Human ZBTB17, His-tagged | +Inquiry |
| ZBTB17-01H | Recombinant Human ZBTB17 Protein, His-tagged | +Inquiry |
| ZBTB17-678H | Recombinant Human ZBTB17 Protein, Myc/DDK-tagged | +Inquiry |
| ZBTB17-020H | Recombinant Human ZBTB17 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZBTB17-219HCL | Recombinant Human ZBTB17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZBTB17 Products
Required fields are marked with *
My Review for All ZBTB17 Products
Required fields are marked with *
