Recombinant Human ZBTB9 Protein, HIS-tagged

• Cat.No.: ZBTB9-088H
• Product Overview: Recombinant Human ZBTB9 fused with His tag at C-termina was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: May be involved in transcriptional regulation.
• Form: Lyophilized from a 0.2 µM filtered solution of PBS, pH7.4
• Molecular Mass: 51.7kD
• AA Sequence: METPTPLPPVPASPTCNPAPRTIQIEFPQHSSSLLESLNRHRLEGKFCDVSLLVQGRELRAHKAVLAAASPYFHDKLLLGDAPRLTLPSVIEADAFEGLLQLIYSGRLRLPLDALPAHLLVASGLQMWQVVDQCSEILRELETSGGGISARGGNSYHALLSTTSSTGGWCIRSSPFQTPVQSSASTESPASTESPVGGEGSELGEVLQIQVEEEEEEEEDDDDEDQGSATLSQTPQPQRVSGVFPRPHGPHPLPM
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: ZBTB9 zinc finger and BTB domain containing 9 [ Homo sapiens ]
• Official Symbol: ZBTB9
• Synonyms: ZBTB9; zinc finger and BTB domain containing 9; zinc finger and BTB domain-containing protein 9; MGC23166; ZNF919
• Gene ID: 221504
• mRNA Refseq: NM_152735
• Protein Refseq: NP_689948
• UniProt ID: Q96C00