Recombinant Human ZC3H14 protein, GST-tagged
Cat.No. : | ZC3H14-3725H |
Product Overview : | Recombinant Human ZC3H14 protein(120-369 aa), fused to GST tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 120-369 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MPSARPEKRDSRVSTSSQESKTTNVRQTYDDGAATRLMSTVKPLREPAPSEDVIDIKPEPDDLIDEDLNFVQENPLSQKKPTVTLTYGSSRPSIEIYRPPASRNADSGVHLNRLQFQQQQNSIHAAKQLDMQSSWVYETGRLCEPEVLNSLEETYSPFFRNNSEKMSMEDENFRKRKLPVVSSVVKVKKFNHDGEEEEEDDDYGSRTGSISSSVSVPAKPERRPSLPPSKQANKNLILKAISEAQESVTKT |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ZC3H14 zinc finger CCCH-type containing 14 [ Homo sapiens ] |
Official Symbol | ZC3H14 |
Synonyms | ZC3H14; zinc finger CCCH-type containing 14; zinc finger CCCH domain-containing protein 14; FLJ11806; NY REN 37; UKp68; nuclear protein UKp68; renal carcinoma antigen NY-REN-37; mammalian suppressor of tau pathology-2; SUT2; MSUT-2; NY-REN-37; MGC26892; |
Gene ID | 79882 |
mRNA Refseq | NM_001160103 |
Protein Refseq | NP_001153575 |
MIM | 613279 |
UniProt ID | Q6PJT7 |
◆ Recombinant Proteins | ||
ZC3H14-1957C | Recombinant Chicken ZC3H14 | +Inquiry |
ZC3H14-10294M | Recombinant Mouse ZC3H14 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZC3H14-18744M | Recombinant Mouse ZC3H14 Protein | +Inquiry |
ZC3H14-5078R | Recombinant Rhesus Macaque ZC3H14 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZC3H14-5265R | Recombinant Rhesus monkey ZC3H14 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZC3H14-1958HCL | Recombinant Human ZC3H14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZC3H14 Products
Required fields are marked with *
My Review for All ZC3H14 Products
Required fields are marked with *
0
Inquiry Basket