Recombinant Human ZC3H14 protein, GST-tagged

• Cat.No.: ZC3H14-3725H
• Product Overview: Recombinant Human ZC3H14 protein(120-369 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 120-369 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MPSARPEKRDSRVSTSSQESKTTNVRQTYDDGAATRLMSTVKPLREPAPSEDVIDIKPEPDDLIDEDLNFVQENPLSQKKPTVTLTYGSSRPSIEIYRPPASRNADSGVHLNRLQFQQQQNSIHAAKQLDMQSSWVYETGRLCEPEVLNSLEETYSPFFRNNSEKMSMEDENFRKRKLPVVSSVVKVKKFNHDGEEEEEDDDYGSRTGSISSSVSVPAKPERRPSLPPSKQANKNLILKAISEAQESVTKT
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ZC3H14 zinc finger CCCH-type containing 14 [ Homo sapiens ]
• Official Symbol: ZC3H14
• Synonyms: ZC3H14; zinc finger CCCH-type containing 14; zinc finger CCCH domain-containing protein 14; FLJ11806; NY REN 37; UKp68; nuclear protein UKp68; renal carcinoma antigen NY-REN-37; mammalian suppressor of tau pathology-2; SUT2; MSUT-2; NY-REN-37; MGC26892
• Gene ID: 79882
• mRNA Refseq: NM_001160103
• Protein Refseq: NP_001153575
• MIM: 613279
• UniProt ID: Q6PJT7