Recombinant Human ZC3H14 protein, GST-tagged

Cat.No. : ZC3H14-3725H
Product Overview : Recombinant Human ZC3H14 protein(120-369 aa), fused to GST tag, was expressed in E. coli.
Availability September 15, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 120-369 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MPSARPEKRDSRVSTSSQESKTTNVRQTYDDGAATRLMSTVKPLREPAPSEDVIDIKPEPDDLIDEDLNFVQENPLSQKKPTVTLTYGSSRPSIEIYRPPASRNADSGVHLNRLQFQQQQNSIHAAKQLDMQSSWVYETGRLCEPEVLNSLEETYSPFFRNNSEKMSMEDENFRKRKLPVVSSVVKVKKFNHDGEEEEEDDDYGSRTGSISSSVSVPAKPERRPSLPPSKQANKNLILKAISEAQESVTKT
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name ZC3H14 zinc finger CCCH-type containing 14 [ Homo sapiens ]
Official Symbol ZC3H14
Synonyms ZC3H14; zinc finger CCCH-type containing 14; zinc finger CCCH domain-containing protein 14; FLJ11806; NY REN 37; UKp68; nuclear protein UKp68; renal carcinoma antigen NY-REN-37; mammalian suppressor of tau pathology-2; SUT2; MSUT-2; NY-REN-37; MGC26892;
Gene ID 79882
mRNA Refseq NM_001160103
Protein Refseq NP_001153575
MIM 613279
UniProt ID Q6PJT7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZC3H14 Products

Required fields are marked with *

My Review for All ZC3H14 Products

Required fields are marked with *

0
cart-icon