Recombinant Human ZCCHC12 protein, His-tagged
| Cat.No. : | ZCCHC12-2568H |
| Product Overview : | Recombinant Human ZCCHC12 protein(154-402 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | January 13, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 154-402 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | VQLQNAIQAGIIAEKDANRTRLQQLLLGGELSRDLRLRLKDFLRMYANEQERLPNFLELIRMVREEEDWDDAFIKRKRPKRSESMVERAVSPVAFQGSPPIVIGSADCNVIEIDDTLDDSDEDVILVESQDPPLPSWGAPPLRDRARPQDEVLVIDSPHNSRAQFPSTSGGSGYKNNGPGEMRRARKRKHTIRCSYCGEEGHSKETCDNESDKAQVFENLIITLQELTHTEMERSRVAPGEYNDFSEPL |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | ZCCHC12 zinc finger, CCHC domain containing 12 [ Homo sapiens ] |
| Official Symbol | ZCCHC12 |
| Synonyms | ZCCHC12; zinc finger, CCHC domain containing 12; zinc finger CCHC domain-containing protein 12; FLJ16123; paraneoplastic Ma antigen family member 7A; PNMA7A; SIZN; SIZN1; 2810028A01Rik; smad-interacting zinc finger protein 1; |
| Gene ID | 170261 |
| mRNA Refseq | NM_173798 |
| Protein Refseq | NP_776159 |
| MIM | 300701 |
| UniProt ID | Q6PEW1 |
| ◆ Recombinant Proteins | ||
| ZCCHC12-6311R | Recombinant Rat ZCCHC12 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ZCCHC12-6655R | Recombinant Rat ZCCHC12 Protein | +Inquiry |
| ZCCHC12-5270R | Recombinant Rhesus monkey ZCCHC12 Protein, His-tagged | +Inquiry |
| ZCCHC12-211H | Recombinant Human ZCCHC12, His-tagged | +Inquiry |
| ZCCHC12-2568H | Recombinant Human ZCCHC12 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZCCHC12-204HCL | Recombinant Human ZCCHC12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZCCHC12 Products
Required fields are marked with *
My Review for All ZCCHC12 Products
Required fields are marked with *
