Recombinant Human ZCCHC12 protein, His-tagged

Cat.No. : ZCCHC12-2568H
Product Overview : Recombinant Human ZCCHC12 protein(154-402 aa), fused to His tag, was expressed in E. coli.
Availability June 13, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 154-402 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : VQLQNAIQAGIIAEKDANRTRLQQLLLGGELSRDLRLRLKDFLRMYANEQERLPNFLELIRMVREEEDWDDAFIKRKRPKRSESMVERAVSPVAFQGSPPIVIGSADCNVIEIDDTLDDSDEDVILVESQDPPLPSWGAPPLRDRARPQDEVLVIDSPHNSRAQFPSTSGGSGYKNNGPGEMRRARKRKHTIRCSYCGEEGHSKETCDNESDKAQVFENLIITLQELTHTEMERSRVAPGEYNDFSEPL
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name ZCCHC12 zinc finger, CCHC domain containing 12 [ Homo sapiens ]
Official Symbol ZCCHC12
Synonyms ZCCHC12; zinc finger, CCHC domain containing 12; zinc finger CCHC domain-containing protein 12; FLJ16123; paraneoplastic Ma antigen family member 7A; PNMA7A; SIZN; SIZN1; 2810028A01Rik; smad-interacting zinc finger protein 1;
Gene ID 170261
mRNA Refseq NM_173798
Protein Refseq NP_776159
MIM 300701
UniProt ID Q6PEW1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZCCHC12 Products

Required fields are marked with *

My Review for All ZCCHC12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon