Recombinant Human ZCCHC12 protein, His-tagged
Cat.No. : | ZCCHC12-2568H |
Product Overview : | Recombinant Human ZCCHC12 protein(154-402 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 154-402 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | VQLQNAIQAGIIAEKDANRTRLQQLLLGGELSRDLRLRLKDFLRMYANEQERLPNFLELIRMVREEEDWDDAFIKRKRPKRSESMVERAVSPVAFQGSPPIVIGSADCNVIEIDDTLDDSDEDVILVESQDPPLPSWGAPPLRDRARPQDEVLVIDSPHNSRAQFPSTSGGSGYKNNGPGEMRRARKRKHTIRCSYCGEEGHSKETCDNESDKAQVFENLIITLQELTHTEMERSRVAPGEYNDFSEPL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ZCCHC12 zinc finger, CCHC domain containing 12 [ Homo sapiens ] |
Official Symbol | ZCCHC12 |
Synonyms | ZCCHC12; zinc finger, CCHC domain containing 12; zinc finger CCHC domain-containing protein 12; FLJ16123; paraneoplastic Ma antigen family member 7A; PNMA7A; SIZN; SIZN1; 2810028A01Rik; smad-interacting zinc finger protein 1; |
Gene ID | 170261 |
mRNA Refseq | NM_173798 |
Protein Refseq | NP_776159 |
MIM | 300701 |
UniProt ID | Q6PEW1 |
◆ Recombinant Proteins | ||
ZCCHC12-2568H | Recombinant Human ZCCHC12 protein, His-tagged | +Inquiry |
ZCCHC12-6311R | Recombinant Rat ZCCHC12 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZCCHC12-5270R | Recombinant Rhesus monkey ZCCHC12 Protein, His-tagged | +Inquiry |
ZCCHC12-6655R | Recombinant Rat ZCCHC12 Protein | +Inquiry |
ZCCHC12-211H | Recombinant Human ZCCHC12, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZCCHC12-204HCL | Recombinant Human ZCCHC12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZCCHC12 Products
Required fields are marked with *
My Review for All ZCCHC12 Products
Required fields are marked with *
0
Inquiry Basket