Recombinant Human ZCCHC17, His-tagged

Cat.No. : ZCCHC17-31651TH
Product Overview : Recombinant full length Human ZCCHC17 with an N terminal His tag; 264 amino acids with the tag, predicted mwt: 30 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 241 amino acids
Description : ZCCHC17, also known as pNO40 or PS1D, is a 241 amino acid protein that interacts with both Pinin and the 60S ribosomal subunit.
Conjugation : HIS
Molecular Weight : 30.000kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, 0.1mM PMSF, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSMNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRRRSFQDYTGQKITLEAVLNTTCKKCGCKGHFAKDCFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKHRDRKSSDSDSSDSESDTGKRARHTSKDSKAAKKKKKKKKHKKKHKE
Sequence Similarities : Contains 1 CCHC-type zinc finger.Contains 1 S1 motif domain.
Gene Name ZCCHC17 zinc finger, CCHC domain containing 17 [ Homo sapiens ]
Official Symbol ZCCHC17
Synonyms ZCCHC17; zinc finger, CCHC domain containing 17; nucleolar protein of 40 kDa; HSPC251; pNO40; PS1D;
Gene ID 51538
mRNA Refseq NM_016505
Protein Refseq NP_057589
Uniprot ID Q9NP64
Chromosome Location 1p35.2
Function RNA binding; metal ion binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZCCHC17 Products

Required fields are marked with *

My Review for All ZCCHC17 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon