Recombinant Human ZCCHC17, His-tagged
| Cat.No. : | ZCCHC17-31651TH |
| Product Overview : | Recombinant full length Human ZCCHC17 with an N terminal His tag; 264 amino acids with the tag, predicted mwt: 30 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 241 amino acids |
| Description : | ZCCHC17, also known as pNO40 or PS1D, is a 241 amino acid protein that interacts with both Pinin and the 60S ribosomal subunit. |
| Conjugation : | HIS |
| Molecular Weight : | 30.000kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, 0.1mM PMSF, pH 8.0 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSMNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRRRSFQDYTGQKITLEAVLNTTCKKCGCKGHFAKDCFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKHRDRKSSDSDSSDSESDTGKRARHTSKDSKAAKKKKKKKKHKKKHKE |
| Sequence Similarities : | Contains 1 CCHC-type zinc finger.Contains 1 S1 motif domain. |
| Gene Name | ZCCHC17 zinc finger, CCHC domain containing 17 [ Homo sapiens ] |
| Official Symbol | ZCCHC17 |
| Synonyms | ZCCHC17; zinc finger, CCHC domain containing 17; nucleolar protein of 40 kDa; HSPC251; pNO40; PS1D; |
| Gene ID | 51538 |
| mRNA Refseq | NM_016505 |
| Protein Refseq | NP_057589 |
| Uniprot ID | Q9NP64 |
| Chromosome Location | 1p35.2 |
| Function | RNA binding; metal ion binding; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| ZCCHC17-3465H | Recombinant Human ZCCHC17 protein, His-tagged | +Inquiry |
| ZCCHC17-5085R | Recombinant Rhesus Macaque ZCCHC17 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ZCCHC17-838C | Recombinant Cynomolgus Monkey ZCCHC17 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ZCCHC17-10827Z | Recombinant Zebrafish ZCCHC17 | +Inquiry |
| ZCCHC17-7101C | Recombinant Chicken ZCCHC17 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZCCHC17-202HCL | Recombinant Human ZCCHC17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZCCHC17 Products
Required fields are marked with *
My Review for All ZCCHC17 Products
Required fields are marked with *
