Recombinant Human ZCCHC17, His-tagged
Cat.No. : | ZCCHC17-31651TH |
Product Overview : | Recombinant full length Human ZCCHC17 with an N terminal His tag; 264 amino acids with the tag, predicted mwt: 30 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 241 amino acids |
Description : | ZCCHC17, also known as pNO40 or PS1D, is a 241 amino acid protein that interacts with both Pinin and the 60S ribosomal subunit. |
Conjugation : | HIS |
Molecular Weight : | 30.000kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, 0.1mM PMSF, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSMNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMKNDRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRRRSFQDYTGQKITLEAVLNTTCKKCGCKGHFAKDCFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKHRDRKSSDSDSSDSESDTGKRARHTSKDSKAAKKKKKKKKHKKKHKE |
Sequence Similarities : | Contains 1 CCHC-type zinc finger.Contains 1 S1 motif domain. |
Gene Name | ZCCHC17 zinc finger, CCHC domain containing 17 [ Homo sapiens ] |
Official Symbol | ZCCHC17 |
Synonyms | ZCCHC17; zinc finger, CCHC domain containing 17; nucleolar protein of 40 kDa; HSPC251; pNO40; PS1D; |
Gene ID | 51538 |
mRNA Refseq | NM_016505 |
Protein Refseq | NP_057589 |
Uniprot ID | Q9NP64 |
Chromosome Location | 1p35.2 |
Function | RNA binding; metal ion binding; zinc ion binding; |
◆ Recombinant Proteins | ||
ZCCHC17-31651TH | Recombinant Human ZCCHC17, His-tagged | +Inquiry |
ZCCHC17-5085R | Recombinant Rhesus Macaque ZCCHC17 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZCCHC17-1095C | Recombinant Cynomolgus ZCCHC17 Protein, His-tagged | +Inquiry |
ZCCHC17-7101C | Recombinant Chicken ZCCHC17 | +Inquiry |
ZCCHC17-6036H | Recombinant Human ZCCHC17 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZCCHC17-202HCL | Recombinant Human ZCCHC17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZCCHC17 Products
Required fields are marked with *
My Review for All ZCCHC17 Products
Required fields are marked with *
0
Inquiry Basket