Recombinant Human ZCCHC17, His-tagged
| Cat.No. : | ZCCHC17-31652TH |
| Product Overview : | Recombinant full length protein, corresponding to amino acids 1-241 of Human ZCCHC17 with N terminal His tag; MWt 34kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-241 a.a. |
| Description : | ZCCHC17, also known as pNO40 or PS1D, is a 241 amino acid protein that interacts with both Pinin and the 60S ribosomal subunit. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitution with 123 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRK QGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMKN DRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRRRSFQ DYTGQKITLEAVLNTTCKKCGCKGHFAKDCFMQPGGTK YSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKHRDRKSSDSDSSDSESDTGKRARHTSKDSKAAKKKKKK KKHKKKHKE |
| Sequence Similarities : | Contains 1 CCHC-type zinc finger.Contains 1 S1 motif domain. |
| Full Length : | Full L. |
| Gene Name | ZCCHC17 zinc finger, CCHC domain containing 17 [ Homo sapiens ] |
| Official Symbol | ZCCHC17 |
| Synonyms | ZCCHC17; zinc finger, CCHC domain containing 17; nucleolar protein of 40 kDa; HSPC251; pNO40; PS1D; |
| Gene ID | 51538 |
| mRNA Refseq | NM_016505 |
| Protein Refseq | NP_057589 |
| Uniprot ID | Q9NP64 |
| Chromosome Location | 1p35.2 |
| Function | RNA binding; metal ion binding; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| ZCCHC17-5085R | Recombinant Rhesus Macaque ZCCHC17 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ZCCHC17-1095C | Recombinant Cynomolgus ZCCHC17 Protein, His-tagged | +Inquiry |
| ZCCHC17-7101C | Recombinant Chicken ZCCHC17 | +Inquiry |
| ZCCHC17-838C | Recombinant Cynomolgus Monkey ZCCHC17 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ZCCHC17-10827Z | Recombinant Zebrafish ZCCHC17 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZCCHC17-202HCL | Recombinant Human ZCCHC17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZCCHC17 Products
Required fields are marked with *
My Review for All ZCCHC17 Products
Required fields are marked with *
