Recombinant Human ZDHHC23 protein, His-tagged
| Cat.No. : | ZDHHC23-2861H |
| Product Overview : | Recombinant Human ZDHHC23 protein(1-83 aa), fused to His tag, was expressed in E. coli. |
| Availability | February 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-83 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MTQKGSMKPVKKKKTEEPELEPLCCCEYIDRNGEKNHVATCLCDCQDLDEGCDRWITCKSLQPETCERIMDTISDRLRIPWLR |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ZDHHC23 zinc finger, DHHC-type containing 23 [ Homo sapiens ] |
| Official Symbol | ZDHHC23 |
| Synonyms | NIDD |
| Gene ID | 254887 |
| mRNA Refseq | NM_173570.3 |
| Protein Refseq | NP_775841.2 |
| UniProt ID | Q8IYP9 |
| ◆ Recombinant Proteins | ||
| RFL35938MF | Recombinant Full Length Mouse Probable Palmitoyltransferase Zdhhc23(Zdhhc23) Protein, His-Tagged | +Inquiry |
| ZDHHC23-18790M | Recombinant Mouse ZDHHC23 Protein | +Inquiry |
| ZDHHC23-10319M | Recombinant Mouse ZDHHC23 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ZDHHC23-301264H | Recombinant Human ZDHHC23 protein, GST-tagged | +Inquiry |
| ZDHHC23-2045C | Recombinant Chicken ZDHHC23 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZDHHC23-1971HCL | Recombinant Human ZDHHC23 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZDHHC23 Products
Required fields are marked with *
My Review for All ZDHHC23 Products
Required fields are marked with *
