Recombinant Human ZDHHC23 protein, His-tagged
Cat.No. : | ZDHHC23-2861H |
Product Overview : | Recombinant Human ZDHHC23 protein(1-83 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-83 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MTQKGSMKPVKKKKTEEPELEPLCCCEYIDRNGEKNHVATCLCDCQDLDEGCDRWITCKSLQPETCERIMDTISDRLRIPWLR |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ZDHHC23 zinc finger, DHHC-type containing 23 [ Homo sapiens ] |
Official Symbol | ZDHHC23 |
Synonyms | NIDD |
Gene ID | 254887 |
mRNA Refseq | NM_173570.3 |
Protein Refseq | NP_775841.2 |
UniProt ID | Q8IYP9 |
◆ Recombinant Proteins | ||
ZDHHC23-301264H | Recombinant Human ZDHHC23 protein, GST-tagged | +Inquiry |
RFL35938MF | Recombinant Full Length Mouse Probable Palmitoyltransferase Zdhhc23(Zdhhc23) Protein, His-Tagged | +Inquiry |
ZDHHC23-10319M | Recombinant Mouse ZDHHC23 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL24911RF | Recombinant Full Length Rat Probable Palmitoyltransferase Zdhhc23(Zdhhc23) Protein, His-Tagged | +Inquiry |
ZDHHC23-2861H | Recombinant Human ZDHHC23 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZDHHC23-1971HCL | Recombinant Human ZDHHC23 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZDHHC23 Products
Required fields are marked with *
My Review for All ZDHHC23 Products
Required fields are marked with *
0
Inquiry Basket