Recombinant Human ZDHHC5 protein(60-148aa), His-tagged
| Cat.No. : | ZDHHC5-795H |
| Product Overview : | Recombinant Human ZDHHC5 protein(Q9C0B5)(60-148aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 60-148aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 16.6 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | ANFSMATFMDPGIFPRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRY |
| Gene Name | ZDHHC5 zinc finger, DHHC-type containing 5 [ Homo sapiens ] |
| Official Symbol | ZDHHC5 |
| Synonyms | ZDHHC5; zinc finger, DHHC-type containing 5; palmitoyltransferase ZDHHC5; KIAA1748; ZNF375; DHHC-5; zinc finger protein 375; probable palmitoyltransferase ZDHHC5; zinc finger, DHHC domain containing 5; zinc finger DHHC domain-containing protein 5; membrane-associated DHHC5 zinc finger protein; DHHC5; DKFZp586K0524; |
| Gene ID | 25921 |
| mRNA Refseq | NM_015457 |
| Protein Refseq | NP_056272 |
| MIM | 614586 |
| UniProt ID | Q9C0B5 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZDHHC5 Products
Required fields are marked with *
My Review for All ZDHHC5 Products
Required fields are marked with *
