Recombinant Human ZDHHC5 protein, His-tagged

Cat.No. : ZDHHC5-7322H
Product Overview : Recombinant Human ZDHHC5 protein(Q9C0B5)(60-148aa), fused with N-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 60-148aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 12.6 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : ANFSMATFMDPGIFPRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRY
Gene Name ZDHHC5 zinc finger, DHHC-type containing 5 [ Homo sapiens ]
Official Symbol ZDHHC5
Synonyms ZDHHC5; zinc finger, DHHC-type containing 5; palmitoyltransferase ZDHHC5; KIAA1748; ZNF375; DHHC-5; zinc finger protein 375; probable palmitoyltransferase ZDHHC5; zinc finger, DHHC domain containing 5; zinc finger DHHC domain-containing protein 5; membrane-associated DHHC5 zinc finger protein; DHHC5; DKFZp586K0524;
Gene ID 25921
mRNA Refseq NM_015457
Protein Refseq NP_056272
MIM 614586
UniProt ID Q9C0B5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZDHHC5 Products

Required fields are marked with *

My Review for All ZDHHC5 Products

Required fields are marked with *

0
cart-icon
0
compare icon