Recombinant Human ZEB1 Protein, GST-tagged

• Cat.No.: ZEB1-22H
• Product Overview: Recombinant Human ZEB1(801 a.a. - 900 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 801 a.a. - 900 a.a.
• Description: This gene encodes a zinc finger transcription factor. The encoded protein likely plays a role in transcriptional repression of interleukin 2. Mutations in this gene have been associated with posterior polymorphous corneal dystrophy-3 and late-onset Fuchs endothelial corneal dystrophy. Alternatively spliced transcript variants encoding different isoforms have been described.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: NIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE
• Applications: Enzyme-linked Immunoabsorbent; Assay Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: ZEB1 zinc finger E-box binding homeobox 1 [ Homo sapiens ]
• Official Symbol: ZEB1
• Synonyms: ZEB1; zinc finger E-box binding homeobox 1; posterior polymorphous corneal dystrophy 3 , PPCD3, TCF8, transcription factor 8 (represses interleukin 2 expression); zinc finger E-box-binding homeobox 1; AREB6; BZP; NIL 2 A; ZEB; Zfhep; Zfhx1a; negative regulator of IL2; delta-crystallin enhancer binding factor 1; posterior polymorphous corneal dystrophy 3; zinc finger homeodomain enhancer-binding protein; transcription factor 8 (represses interleukin 2 expression); TCF8; FECD6; NIL2A; PPCD3; ZFHEP; ZFHX1A; DELTAEF1; MGC133261
• Gene ID: 6935
• mRNA Refseq: NM_001128128
• Protein Refseq: NP_001121600
• MIM: 189909
• UniProt ID: P37275