Recombinant Human ZFP36 Protein, His-tagged

Cat.No. : ZFP36-3801H
Product Overview : Recombinant Human ZFP36 Protien(NP_003398)(1-326 aa), fused to His tag, was expressed in E. coli.
Availability June 13, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-326 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Gene Name ZFP36 zinc finger protein 36, C3H type, homolog (mouse) [ Homo sapiens ]
Official Symbol ZFP36
Synonyms ZFP36; zinc finger protein 36, C3H type, homolog (mouse); zinc finger protein, C3H type, 36 homolog (mouse); tristetraprolin; G0S24; NUP475; RNF162A; TIS11; TTP; zfp-36; tristetraproline; zinc finger protein 36 homolog; G0/G1 switch regulatory protein 24; zinc finger protein, C3H type, 36 homolog; growth factor-inducible nuclear protein NUP475; GOS24;
Gene ID 7538
mRNA Refseq NM_003407
Protein Refseq NP_003398
MIM 190700
UniProt ID P26651

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZFP36 Products

Required fields are marked with *

My Review for All ZFP36 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon