Recombinant Human ZFP36 Protein, His-tagged
Cat.No. : | ZFP36-3801H |
Product Overview : | Recombinant Human ZFP36 Protien(NP_003398)(1-326 aa), fused to His tag, was expressed in E. coli. |
Availability | September 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-326 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | ZFP36 zinc finger protein 36, C3H type, homolog (mouse) [ Homo sapiens ] |
Official Symbol | ZFP36 |
Synonyms | ZFP36; zinc finger protein 36, C3H type, homolog (mouse); zinc finger protein, C3H type, 36 homolog (mouse); tristetraprolin; G0S24; NUP475; RNF162A; TIS11; TTP; zfp-36; tristetraproline; zinc finger protein 36 homolog; G0/G1 switch regulatory protein 24; zinc finger protein, C3H type, 36 homolog; growth factor-inducible nuclear protein NUP475; GOS24; |
Gene ID | 7538 |
mRNA Refseq | NM_003407 |
Protein Refseq | NP_003398 |
MIM | 190700 |
UniProt ID | P26651 |
◆ Recombinant Proteins | ||
ZFP36-31616TH | Recombinant Human ZFP36 | +Inquiry |
ZFP36-10345M | Recombinant Mouse ZFP36 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZFP36-18904M | Recombinant Mouse ZFP36 Protein | +Inquiry |
ZFP36-3801H | Recombinant Human ZFP36 Protein, His-tagged | +Inquiry |
ZFP36-313H | Recombinant Human ZFP36 Protein, GST/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZFP36-181HCL | Recombinant Human ZFP36 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZFP36 Products
Required fields are marked with *
My Review for All ZFP36 Products
Required fields are marked with *