Recombinant Human ZKSCAN7 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ZKSCAN7-922H
Product Overview : ZNF167 MS Standard C13 and N15-labeled recombinant protein (NP_079445) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : May be involved in transcriptional regulation.
Molecular Mass : 30.6 kDa
AA Sequence : MTTAGRGNLGLIPRSTAFQKQEGRLTVKQEPANQTWGQGSSLQKNYPPVCEIFRLHFRQLCYHEMSGPQEALSRLRELCRWWLMPEVHTKEQILELLVLEQFLSILPGELRTWVQLHHPESGEEAVAVVEDFQRHLSGSEEVSAPAQKQEMHFEETTALGTTKESPPTSPLSGGSAPGAHLEPPYDPGTHHLPSGDFAQCTSPVPTLPQVGNSGDQAGATVLRMVRPQDTVAYEDLSVDYTQKKWKSLTLSQRALQWNMMPENHHSMASLGWSTMATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ZKSCAN7 zinc finger with KRAB and SCAN domains 7 [ Homo sapiens (human) ]
Official Symbol ZKSCAN7
Synonyms ZKSCAN7; zinc finger with KRAB and SCAN domains 7; ZFP; ZNF64; ZNF167; ZNF448; ZSCAN39; zinc finger protein with KRAB and SCAN domains 7; zinc finger protein 167; zinc finger protein 448; zinc finger protein 64
Gene ID 55888
mRNA Refseq NM_025169
Protein Refseq NP_079445
UniProt ID Q9P0L1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZKSCAN7 Products

Required fields are marked with *

My Review for All ZKSCAN7 Products

Required fields are marked with *

0
cart-icon