Recombinant Human ZKSCAN7 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ZKSCAN7-922H |
Product Overview : | ZNF167 MS Standard C13 and N15-labeled recombinant protein (NP_079445) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | May be involved in transcriptional regulation. |
Molecular Mass : | 30.6 kDa |
AA Sequence : | MTTAGRGNLGLIPRSTAFQKQEGRLTVKQEPANQTWGQGSSLQKNYPPVCEIFRLHFRQLCYHEMSGPQEALSRLRELCRWWLMPEVHTKEQILELLVLEQFLSILPGELRTWVQLHHPESGEEAVAVVEDFQRHLSGSEEVSAPAQKQEMHFEETTALGTTKESPPTSPLSGGSAPGAHLEPPYDPGTHHLPSGDFAQCTSPVPTLPQVGNSGDQAGATVLRMVRPQDTVAYEDLSVDYTQKKWKSLTLSQRALQWNMMPENHHSMASLGWSTMATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ZKSCAN7 zinc finger with KRAB and SCAN domains 7 [ Homo sapiens (human) ] |
Official Symbol | ZKSCAN7 |
Synonyms | ZKSCAN7; zinc finger with KRAB and SCAN domains 7; ZFP; ZNF64; ZNF167; ZNF448; ZSCAN39; zinc finger protein with KRAB and SCAN domains 7; zinc finger protein 167; zinc finger protein 448; zinc finger protein 64 |
Gene ID | 55888 |
mRNA Refseq | NM_025169 |
Protein Refseq | NP_079445 |
UniProt ID | Q9P0L1 |
◆ Recombinant Proteins | ||
ZKSCAN7-922H | Recombinant Human ZKSCAN7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ZKSCAN7-437H | Recombinant Human ZKSCAN7 Protein, MYC/DDK-tagged | +Inquiry |
Zkscan7-7113M | Recombinant Mouse Zkscan7 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZKSCAN7 Products
Required fields are marked with *
My Review for All ZKSCAN7 Products
Required fields are marked with *