Recombinant Human ZMAT5 Protein (1-170 aa), His-SUMO-tagged
Cat.No. : | ZMAT5-1122H |
Product Overview : | Recombinant Human ZMAT5 Protein (1-170 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-170 aa |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 36.0 kDa |
AA Sequence : | MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQCDFGSNCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKRLSSAPSSRAEPIRTTVFQYPVGWPPVQELPPSLRAPPPGGWPLQPRVQWG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | ZMAT5 zinc finger, matrin-type 5 [ Homo sapiens ] |
Official Symbol | ZMAT5 |
Synonyms | ZMAT5; U11/U12-20K; zinc finger, matrin type 5; |
Gene ID | 55954 |
mRNA Refseq | NM_001003692 |
Protein Refseq | NP_001003692 |
UniProt ID | Q9UDW3 |
◆ Recombinant Proteins | ||
ZMAT5-2587H | Recombinant Human ZMAT5 protein, His-tagged | +Inquiry |
ZMAT5-10389M | Recombinant Mouse ZMAT5 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZMAT5-1227H | Recombinant Human ZMAT5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ZMAT5-5110R | Recombinant Rhesus Macaque ZMAT5 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZMAT5-4905C | Recombinant Chicken ZMAT5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZMAT5-155HCL | Recombinant Human ZMAT5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZMAT5 Products
Required fields are marked with *
My Review for All ZMAT5 Products
Required fields are marked with *