Recombinant Human ZMYND10 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ZMYND10-2546H |
Product Overview : | ZMYND10 MS Standard C13 and N15-labeled recombinant protein (NP_056980) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein containing a MYND-type zinc finger domain that likely functions in assembly of the dynein motor. Mutations in this gene can cause primary ciliary dyskinesia. This gene is also considered a tumor suppressor gene and is often mutated, deleted, or hypermethylated and silenced in cancer cells. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 50.3 kDa |
AA Sequence : | MGDLELLLPGEAEVLVRGLRSFPLREMGSEGWNQQHENLEKLNMQAILDATVSQGEPIQELLVTHGKVPTLVEELIAVEMWKQKVFPVFCRVEDFKPQNTFPIYMVVHHEASIINLLETVFFHKEVCESAEDTVLDLVDYCHRKLTLLVAQSGCGGPPEGEGSQDSNPMQELQKQAELMEFEIALKALSVLRYITDCVDSLSLSTLSRMLSTHNLPCLLVELLEHSPWSRREGGKLQQFEGSRWHTVAPSEQQKLSKLDGQVWIALYNLLLSPEAQARYCLTSFAKGRLLKLRAFLTDTLLDQLPNLAHLQSFLAHLTLTETQPPKKDLVLEQIPEIWERLERENRGKWQAIAKHQLQHVFSPSEQDLRLQARRWAETYRLDVLEAVAPERPRCAYCSAEASKRCSRCQNEWYCCRECQVKHWEKHGKTCVLAAQGDRAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ZMYND10 zinc finger MYND-type containing 10 [ Homo sapiens (human) ] |
Official Symbol | ZMYND10 |
Synonyms | ZMYND10; zinc finger, MYND-type containing 10; zinc finger MYND domain-containing protein 10; BLU; protein BLu; zinc finger, MYND domain containing 10; FLU; |
Gene ID | 51364 |
mRNA Refseq | NM_015896 |
Protein Refseq | NP_056980 |
MIM | 607070 |
UniProt ID | O75800 |
◆ Recombinant Proteins | ||
ZMYND10-6343R | Recombinant Rat ZMYND10 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZMYND10-7935H | Recombinant Human ZMYND10, His-tagged | +Inquiry |
ZMYND10-10711Z | Recombinant Zebrafish ZMYND10 | +Inquiry |
ZMYND10-10394M | Recombinant Mouse ZMYND10 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZMYND10-6711R | Recombinant Rat ZMYND10 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZMYND10-152HCL | Recombinant Human ZMYND10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZMYND10 Products
Required fields are marked with *
My Review for All ZMYND10 Products
Required fields are marked with *