Recombinant Human ZNF143 protein, His-tagged
| Cat.No. : | ZNF143-3818H |
| Product Overview : | Recombinant Human ZNF143 protein(283-626 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | December 11, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 283-626 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | KPYRCSEDNCTKSFKTSGDLQKHIRTHTGERPFKCPFEGCGRSFTTSNIRKVHVRTHTGERPYYCTEPGCGRAFASATNYKNHVRIHTGEKPYVCTVPGCDKRFTEYSSLYKHHVVHTHSKPYNCNHCGKTYKQISTLVMHKRTAHNDTEPIEEEQEAFFEPPPGQGEDVLKGSQITYVTGVEGDDVVSTQVATVTQSGLSQQVTLISQDGTQHVNISQADMQAIGNTITMVTQDGTPITVPAHDAVISSAGTHSVAMVTAEGTEGQQVAIVAQDLAAFHTASSEMGHQQHSHHLVTTETRPLTLVATSNGTQIAVQLGEQPSLEEAIRIASRIQQGETPGLDD |
| Gene Name | ZNF143 zinc finger protein 143 [ Homo sapiens ] |
| Official Symbol | ZNF143 |
| Synonyms | ZNF143; zinc finger protein 143; zinc finger protein 143 (clone pHZ 1); pHZ 1; SBF; STAF; hStaf; SPH-binding factor; transcriptional activator Staf; selenocysteine tRNA gene transcription-activating factor; pHZ-1; |
| Gene ID | 7702 |
| mRNA Refseq | NM_003442 |
| Protein Refseq | NP_003433 |
| MIM | 603433 |
| UniProt ID | P52747 |
| ◆ Recombinant Proteins | ||
| ZNF143-301583H | Recombinant Human ZNF143 protein, GST-tagged | +Inquiry |
| ZNF143-10400M | Recombinant Mouse ZNF143 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ZFP143-18833M | Recombinant Mouse ZFP143 Protein | +Inquiry |
| ZNF143-6345R | Recombinant Rat ZNF143 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ZNF143-3818H | Recombinant Human ZNF143 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZNF143-142HCL | Recombinant Human ZNF143 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNF143 Products
Required fields are marked with *
My Review for All ZNF143 Products
Required fields are marked with *
