Recombinant Human ZNF146 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: ZNF146-316H
• Product Overview: ZNF146 MS Standard C13 and N15-labeled recombinant protein (NP_009076) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: ZNF146 (Zinc Finger Protein 146) is a Protein Coding gene. Diseases associated with ZNF146 include Verrucous Papilloma. An important paralog of this gene is ZNF260.
• Molecular Mass: 33.1 kDa
• AA Sequence: MSHLSQQKIYSGENPFACKVCGKVFSHKSNLTEHEHFHTREKPFECNECGKAFSQKQYVIKHQNTHTGEKLFECNECGKSFSQKENLLTHQKIHTGEKPFECKDCGKAFIQKSNLIRHQRTHTGEKPFVCKECGKTFSGKSNLTEHEKIHIGEKPFKCSECGTAFGQKKYLIKHQNIHTGEKPYECNECGKAFSQRTSLIVHVRIHSGDKPYECNVCGKAFSQSSSLTVHVRSHTGEKPYGCNECGKAFSQFSTLALHLRIHTGKKPYQCSECGKAFSQKSHHIRHQKIHTHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ZNF146 zinc finger protein 146 [ Homo sapiens (human) ]
• Official Symbol: ZNF146
• Synonyms: ZNF146; zinc finger protein 146; zinc finger protein OZF; OZF; only zinc finger protein; MGC125660; MGC125661
• Gene ID: 7705
• mRNA Refseq: NM_007145
• Protein Refseq: NP_009076
• MIM: 601505
• UniProt ID: Q15072