Recombinant Human ZNF207 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ZNF207-2459H |
Product Overview : | ZNF207 MS Standard C13 and N15-labeled recombinant protein (NP_001091977) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Kinetochore- and microtubule-binding protein that plays a key role in spindle assembly. ZNF207/BuGZ is mainly composed of disordered low-complexity regions and undergoes phase transition or coacervation to form temperature-dependent liquid droplets. Coacervation promotes microtubule bundling and concentrates tubulin, promoting microtubule polymerization and assembly of spindle and spindle matrix by concentrating its building blocks. Also acts as a regulator of mitotic chromosome alignment by mediating the stability and kinetochore loading of BUB3. Mechanisms by which BUB3 is protected are unclear: according to a first report, ZNF207/BuGZ may act by blocking ubiquitination and proteasomal degradation of BUB3. According to another report, the stabilization is independent of the proteasome. |
Molecular Mass : | 52.5 kDa |
AA Sequence : | MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQESQKKKQQDDSDEYDDDDSAASTSFQPQPVQPQQGYIPPMAQPGLPPVPGAPGMPPGIPPLMPGVPPLMPGMPPVMPGMPPGLHHQRKYTQSFCGENIMMPMGGMMPPGPGIPPLMPGMPPGMPPPVPRPGIPPMTQAQAVSAPGILNRPPAPTATVPAPQPPVTKPLFPSAGQMGTPVTSSSTASSNSESLSASSKALFPSTAQAQAAVQGPVGTDFKPLNSTPATTTEPPKPTFPAYTQSTASTTSTTNSTAAKPAASITSKPATLTTTSATSKLIHPDEDISLEERRAQLPKYQRNLPRPGQAPIGNPPVGPIGGMMPPQPGIPQQQGMRPPMPPHGQYGGHHQGMPGYLPGAMPPYGQGPPMVPPYQGGPPRPPMGMRPPVMSQGGRYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ZNF207 zinc finger protein 207 [ Homo sapiens (human) ] |
Official Symbol | ZNF207 |
Synonyms | ZNF207; zinc finger protein 207; DKFZp761N202; |
Gene ID | 7756 |
mRNA Refseq | NM_001098507 |
Protein Refseq | NP_001091977 |
MIM | 603428 |
UniProt ID | O43670 |
◆ Recombinant Proteins | ||
ZNF207-2459H | Recombinant Human ZNF207 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Zfp207-7080M | Recombinant Mouse Zfp207 Protein, Myc/DDK-tagged | +Inquiry |
ZNF207-10403M | Recombinant Mouse ZNF207 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZNF207-5310R | Recombinant Rhesus monkey ZNF207 Protein, His-tagged | +Inquiry |
ZNF207-5123R | Recombinant Rhesus Macaque ZNF207 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF207-122HCL | Recombinant Human ZNF207 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNF207 Products
Required fields are marked with *
My Review for All ZNF207 Products
Required fields are marked with *
0
Inquiry Basket