Recombinant Human ZNF238, His-tagged
Cat.No. : | ZNF238-30757TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 65-360 of Human ZNF238 with N terminal His tag; Predicted MWt 33 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 65-360 a.a. |
Description : | C2H2-type zinc finger proteins, such as ZNF238, act on the molecular level as transcriptional activators or repressors and are involved in chromatin assembly (Becker et al. |
Conjugation : | HIS |
Tissue specificity : | Lymphoid tissues, testis, heart, brain, skeletal muscle, and pancreas and, at much lower level, other tissues. |
Form : | Lyophilised:Reconstitute with 101 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LNSDIVTAPAFALLLEFMYEGKLQFKDLPIEDVLAAASYL HMYDIVKVCKKKLKEKATTEADSTKKEEDASSCSDKVE SLSDGSSHIAGDLPSDEDEGEDEKLNILPSKRDLAAEP GNMWMRLPSDSAGIPQAGGEAEPHATAAGKTVASPCSS TESLSQRSVTSVRDSADVDCVLDLSVKSSLSGVENLNSSYFSSQDVLRSNLVQVKVEKEASCDESDVGTNDYDMEHST VKESVSTNNRVQYEPAHLAPLREDSVLRELDREDKASD DEMMTPESERVQVEGGMESSLLPYVS |
Sequence Similarities : | Contains 1 BTB (POZ) domain.Contains 4 C2H2-type zinc fingers. |
Gene Name | ZNF238 zinc finger protein 238 [ Homo sapiens ] |
Official Symbol | ZNF238 |
Synonyms | ZNF238; zinc finger protein 238; C2H2 171; RP58; TAZ 1; ZBTB18; |
Gene ID | 10472 |
mRNA Refseq | NM_006352 |
Protein Refseq | NP_006343 |
MIM | 608433 |
Uniprot ID | Q99592 |
Chromosome Location | 1q44-ter |
Function | DNA binding; metal ion binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; zinc ion binding; |
◆ Recombinant Proteins | ||
ZFP238-6676R | Recombinant Rat ZFP238 Protein | +Inquiry |
ZNF238-5312R | Recombinant Rhesus monkey ZNF238 Protein, His-tagged | +Inquiry |
ZNF238-5125R | Recombinant Rhesus Macaque ZNF238 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZNF238-30757TH | Recombinant Human ZNF238, His-tagged | +Inquiry |
ZNF238-3828H | Recombinant Human ZNF238, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF238-111HCL | Recombinant Human ZNF238 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNF238 Products
Required fields are marked with *
My Review for All ZNF238 Products
Required fields are marked with *