Recombinant Human ZNF26 Protein (335-533 aa), His-SUMO-tagged
Cat.No. : | ZNF26-854H |
Product Overview : | Recombinant Human ZNF26 Protein (335-533 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 335-533 aa |
Description : | May be involved in transcriptional regulation. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 38.6 kDa |
AA Sequence : | MHTGEKPYQCSDCGKAFNMKTQLIVHQGVHTGNNPYQCGECGKAFGRKEQLTAHLRAHAGEKPYGCSECGKAFSSKSYLVIHRRTHTGERPYECSLCERAFCGKSQLIIHQRTHSTEKPYECNECEKAYPRKASLQIHQKTHSGEKPFKCSECGKAFTQKSSLSEHQRVHTGEKPWKCSECGKSFCWNSGLRIHRKTHK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | ZNF26 zinc finger protein 26 [ Homo sapiens ] |
Official Symbol | ZNF26 |
Synonyms | ZNF26; FLJ20755; KOX20; zinc finger protein KOX20; |
Gene ID | 7574 |
mRNA Refseq | NM_001256279 |
Protein Refseq | NP_001243208 |
MIM | 194537 |
UniProt ID | P17031 |
◆ Recombinant Proteins | ||
ZNF26-854H | Recombinant Human ZNF26 Protein (335-533 aa), His-SUMO-tagged | +Inquiry |
ZNF26-3673H | Recombinant Human ZNF26 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ZNF26-3831H | Recombinant Human ZNF26, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF26-2000HCL | Recombinant Human ZNF26 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZNF26 Products
Required fields are marked with *
My Review for All ZNF26 Products
Required fields are marked with *
0
Inquiry Basket