Recombinant Human ZNF26 Protein (335-533 aa), His-SUMO-tagged
| Cat.No. : | ZNF26-854H |
| Product Overview : | Recombinant Human ZNF26 Protein (335-533 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 335-533 aa |
| Description : | May be involved in transcriptional regulation. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 38.6 kDa |
| AA Sequence : | MHTGEKPYQCSDCGKAFNMKTQLIVHQGVHTGNNPYQCGECGKAFGRKEQLTAHLRAHAGEKPYGCSECGKAFSSKSYLVIHRRTHTGERPYECSLCERAFCGKSQLIIHQRTHSTEKPYECNECEKAYPRKASLQIHQKTHSGEKPFKCSECGKAFTQKSSLSEHQRVHTGEKPWKCSECGKSFCWNSGLRIHRKTHK |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | ZNF26 zinc finger protein 26 [ Homo sapiens ] |
| Official Symbol | ZNF26 |
| Synonyms | ZNF26; FLJ20755; KOX20; zinc finger protein KOX20; |
| Gene ID | 7574 |
| mRNA Refseq | NM_001256279 |
| Protein Refseq | NP_001243208 |
| MIM | 194537 |
| UniProt ID | P17031 |
| ◆ Recombinant Proteins | ||
| ZNF26-3831H | Recombinant Human ZNF26, GST-tagged | +Inquiry |
| ZNF26-3673H | Recombinant Human ZNF26 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ZNF26-854H | Recombinant Human ZNF26 Protein (335-533 aa), His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZNF26-2000HCL | Recombinant Human ZNF26 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNF26 Products
Required fields are marked with *
My Review for All ZNF26 Products
Required fields are marked with *
