Recombinant Human ZNF26 Protein (335-533 aa), His-SUMO-tagged

Cat.No. : ZNF26-854H
Product Overview : Recombinant Human ZNF26 Protein (335-533 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 335-533 aa
Description : May be involved in transcriptional regulation.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 38.6 kDa
AA Sequence : MHTGEKPYQCSDCGKAFNMKTQLIVHQGVHTGNNPYQCGECGKAFGRKEQLTAHLRAHAGEKPYGCSECGKAFSSKSYLVIHRRTHTGERPYECSLCERAFCGKSQLIIHQRTHSTEKPYECNECEKAYPRKASLQIHQKTHSGEKPFKCSECGKAFTQKSSLSEHQRVHTGEKPWKCSECGKSFCWNSGLRIHRKTHK
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name ZNF26 zinc finger protein 26 [ Homo sapiens ]
Official Symbol ZNF26
Synonyms ZNF26; FLJ20755; KOX20; zinc finger protein KOX20;
Gene ID 7574
mRNA Refseq NM_001256279
Protein Refseq NP_001243208
MIM 194537
UniProt ID P17031

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZNF26 Products

Required fields are marked with *

My Review for All ZNF26 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon