Recombinant Human ZNF385C Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ZNF385C-1722H
• Product Overview: ZNF385C MS Standard C13 and N15-labeled recombinant protein (NP_001013646) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: ZNF385C (Zinc Finger Protein 385C) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include nucleic acid binding. An important paralog of this gene is ZNF385D.
• Molecular Mass: 18.2 kDa
• AA Sequence: MEGQRGAPRRSRGRPVSRGGAGHKAKRVTGGRGGRQGPSPAFHCALCQLQVNSETQLKQHMSSRRHKDRLAGKTPKPSSQHSKLQKHAALAVSILKSKLALQKQLTKTLAARFLPSPLPTAATAICALPGPLALRPAPTAATTLFPAPILGPALFRTPAGAVRPATGPIVLAPYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ZNF385C zinc finger protein 385C [ Homo sapiens (human) ]
• Official Symbol: ZNF385C
• Synonyms: ZNF385C; zinc finger protein 385C; zinc finger protein 385C; CTD-2132N18.2; CTD-2132N18.4
• Gene ID: 201181
• mRNA Refseq: NM_001013624
• Protein Refseq: NP_001013646
• UniProt ID: Q66K41