Recombinant Human ZNF385C Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ZNF385C-1722H |
Product Overview : | ZNF385C MS Standard C13 and N15-labeled recombinant protein (NP_001013646) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | ZNF385C (Zinc Finger Protein 385C) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include nucleic acid binding. An important paralog of this gene is ZNF385D. |
Molecular Mass : | 18.2 kDa |
AA Sequence : | MEGQRGAPRRSRGRPVSRGGAGHKAKRVTGGRGGRQGPSPAFHCALCQLQVNSETQLKQHMSSRRHKDRLAGKTPKPSSQHSKLQKHAALAVSILKSKLALQKQLTKTLAARFLPSPLPTAATAICALPGPLALRPAPTAATTLFPAPILGPALFRTPAGAVRPATGPIVLAPYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ZNF385C zinc finger protein 385C [ Homo sapiens (human) ] |
Official Symbol | ZNF385C |
Synonyms | ZNF385C; zinc finger protein 385C; zinc finger protein 385C; CTD-2132N18.2; CTD-2132N18.4 |
Gene ID | 201181 |
mRNA Refseq | NM_001013624 |
Protein Refseq | NP_001013646 |
UniProt ID | Q66K41 |
◆ Recombinant Proteins | ||
ZNF385C-1722H | Recombinant Human ZNF385C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ZNF385C-4324H | Recombinant Human ZNF385C Protein, His (Fc)-Avi-tagged | +Inquiry |
ZNF385C-1827H | Recombinant Human ZNF385C | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF385C-1004HCL | Recombinant Human ZNF385C cell lysate | +Inquiry |
ZNF385C-83HCL | Recombinant Human ZNF385C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZNF385C Products
Required fields are marked with *
My Review for All ZNF385C Products
Required fields are marked with *
0
Inquiry Basket