Recombinant Human ZNF460 protein, GST-tagged
Cat.No. : | ZNF460-3851H |
Product Overview : | Recombinant Human ZNF460 protein(102-211 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 102-211 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MQEYFLRPGTDPQSEKLHGKMSLEHEGLATADGICSMMIQNQVSPEDALYGFDSYGPVTDSLIHEGENSYKFEEMFNENCFLVQHEQILPRVKPYDCPECGKAFGKSKHL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | ZNF460 |
Synonyms | ZNF460; zinc finger protein 460; zinc finger protein 272 , ZNF272; HZF8; zinc finger protein 272; zinc finger protein HZF8; ZNF272; |
Gene ID | 10794 |
mRNA Refseq | NM_006635 |
Protein Refseq | NP_006626 |
MIM | 604755 |
UniProt ID | Q14592 |
◆ Recombinant Proteins | ||
ZNF460-3852H | Recombinant Human ZNF460 protein, His-tagged | +Inquiry |
ZNF460-3851H | Recombinant Human ZNF460 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF460-68HCL | Recombinant Human ZNF460 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZNF460 Products
Required fields are marked with *
My Review for All ZNF460 Products
Required fields are marked with *
0
Inquiry Basket