Recombinant Human ZNF460 protein, GST-tagged
| Cat.No. : | ZNF460-3851H |
| Product Overview : | Recombinant Human ZNF460 protein(102-211 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | November 11, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 102-211 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | MQEYFLRPGTDPQSEKLHGKMSLEHEGLATADGICSMMIQNQVSPEDALYGFDSYGPVTDSLIHEGENSYKFEEMFNENCFLVQHEQILPRVKPYDCPECGKAFGKSKHL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | ZNF460 |
| Synonyms | ZNF460; zinc finger protein 460; zinc finger protein 272 , ZNF272; HZF8; zinc finger protein 272; zinc finger protein HZF8; ZNF272; |
| Gene ID | 10794 |
| mRNA Refseq | NM_006635 |
| Protein Refseq | NP_006626 |
| MIM | 604755 |
| UniProt ID | Q14592 |
| ◆ Recombinant Proteins | ||
| ZNF460-3852H | Recombinant Human ZNF460 protein, His-tagged | +Inquiry |
| ZNF460-3851H | Recombinant Human ZNF460 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZNF460-68HCL | Recombinant Human ZNF460 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNF460 Products
Required fields are marked with *
My Review for All ZNF460 Products
Required fields are marked with *
