Recombinant Human ZNF581 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ZNF581-2845H |
Product Overview : | ZNF581 MS Standard C13 and N15-labeled recombinant protein (NP_057619) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | May be involved in transcriptional regulation. |
Molecular Mass : | 22 kDa |
AA Sequence : | MLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGPSSSIGSPQASSPPRPNHYLLIDTQGVPYTVLVDEESQREPGASGAPGQKKCYSCPVCSRVFEYMSYLQRHSITHSEVKPFECDICGKAFKRASHLARHHSIHLAGGGRPHGCPLCPRRFRDAGELAQHSRVHSGERPFQCPHCPRRFMEQNTLQKHTRWKHPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ZNF581 zinc finger protein 581 [ Homo sapiens (human) ] |
Official Symbol | ZNF581 |
Synonyms | ZNF581; zinc finger protein 581; FLJ22550; HSPC189; |
Gene ID | 51545 |
mRNA Refseq | NM_016535 |
Protein Refseq | NP_057619 |
UniProt ID | Q9P0T4 |
◆ Recombinant Proteins | ||
ZNF581-3782H | Recombinant Human ZNF581 protein, His-SUMO-tagged | +Inquiry |
ZNF581-5156R | Recombinant Rhesus Macaque ZNF581 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZNF581-5343R | Recombinant Rhesus monkey ZNF581 Protein, His-tagged | +Inquiry |
ZNF581-2845H | Recombinant Human ZNF581 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ZNF581-183H | Recombinant Human ZNF581 protein, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF581-43HCL | Recombinant Human ZNF581 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZNF581 Products
Required fields are marked with *
My Review for All ZNF581 Products
Required fields are marked with *
0
Inquiry Basket