Recombinant Human ZNF581 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ZNF581-2845H
Product Overview : ZNF581 MS Standard C13 and N15-labeled recombinant protein (NP_057619) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : May be involved in transcriptional regulation.
Molecular Mass : 22 kDa
AA Sequence : MLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGPSSSIGSPQASSPPRPNHYLLIDTQGVPYTVLVDEESQREPGASGAPGQKKCYSCPVCSRVFEYMSYLQRHSITHSEVKPFECDICGKAFKRASHLARHHSIHLAGGGRPHGCPLCPRRFRDAGELAQHSRVHSGERPFQCPHCPRRFMEQNTLQKHTRWKHPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ZNF581 zinc finger protein 581 [ Homo sapiens (human) ]
Official Symbol ZNF581
Synonyms ZNF581; zinc finger protein 581; FLJ22550; HSPC189;
Gene ID 51545
mRNA Refseq NM_016535
Protein Refseq NP_057619
UniProt ID Q9P0T4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZNF581 Products

Required fields are marked with *

My Review for All ZNF581 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon