"ZNF581" Related Products

Recombinant Human ZNF581 protein, T7-tagged

Cat.No. : ZNF581-183H
Product Overview : Recombinant human ZNF581 (197 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli.
Source : E. coli
Species : Human
Tag : T7
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGEFMLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGPSSSIGSPQASSPPRPNHYLLIDTQG VPYTVLVDEESQREPGASGAPGQKKCYSCPVCSRVFEYMSYLQRHSITHSEVKPFECDICGKAFKRASHLARHHS IHLAGGGRPHGCPLCPRRFRDAGELAQHSRVHSGERPFQCPHCPRRFMEQNTLQKHTRWKHP
Purity : >90% by SDS-PAGE.
Storage : Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name : ZNF581 zinc finger protein 581 [ Homo sapiens ]
Official Symbol : ZNF581
Synonyms : ZNF581; zinc finger protein 581; FLJ22550; HSPC189;
Gene ID : 51545
mRNA Refseq : NM_016535
Protein Refseq : NP_057619
MIM :
UniProt ID : Q9P0T4
Chromosome Location : 19
Function : DNA binding; metal ion binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.