"ZNF581" Related Products

Recombinant Human ZNF581 protein, T7-tagged

Cat.No.: ZNF581-183H
Product Overview: Recombinant human ZNF581 (197 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGEFMLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGPSSSIGSPQASSPPRPNHYLLIDTQG VPYTVLVDEESQREPGASGAPGQKKCYSCPVCSRVFEYMSYLQRHSITHSEVKPFECDICGKAFKRASHLARHHS IHLAGGGRPHGCPLCPRRFRDAGELAQHSRVHSGERPFQCPHCPRRFMEQNTLQKHTRWKHP
Purity: >90% by SDS-PAGE.
Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: ZNF581 zinc finger protein 581 [ Homo sapiens ]
Official Symbol: ZNF581
Synonyms: ZNF581; zinc finger protein 581; FLJ22550; HSPC189;
Gene ID: 51545
mRNA Refseq: NM_016535
Protein Refseq: NP_057619
MIM:
UniProt ID: Q9P0T4
Chromosome Location: 19
Function: DNA binding; metal ion binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.