Recombinant Human ZNF581 protein, T7-tagged
| Cat.No. : | ZNF581-183H |
| Product Overview : | Recombinant human ZNF581 (197 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | T7 |
| Protein Length : | 197 a.a. |
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGEFMLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGPSSSIGSPQASSPPRPNHYLLIDTQG VPYTVLVDEESQREPGASGAPGQKKCYSCPVCSRVFEYMSYLQRHSITHSEVKPFECDICGKAFKRASHLARHHS IHLAGGGRPHGCPLCPRRFRDAGELAQHSRVHSGERPFQCPHCPRRFMEQNTLQKHTRWKHP |
| Purity : | >90% by SDS-PAGE. |
| Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Gene Name | ZNF581 zinc finger protein 581 [ Homo sapiens ] |
| Official Symbol | ZNF581 |
| Synonyms | ZNF581; zinc finger protein 581; FLJ22550; HSPC189; |
| Gene ID | 51545 |
| mRNA Refseq | NM_016535 |
| Protein Refseq | NP_057619 |
| MIM | |
| UniProt ID | Q9P0T4 |
| Chromosome Location | 19 |
| Function | DNA binding; metal ion binding; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| ZNF581-183H | Recombinant Human ZNF581 protein, T7-tagged | +Inquiry |
| ZNF581-3019H | Recombinant Human Zinc Finger Protein 581, T7-tagged | +Inquiry |
| ZNF581-3782H | Recombinant Human ZNF581 protein, His-SUMO-tagged | +Inquiry |
| ZNF581-5343R | Recombinant Rhesus monkey ZNF581 Protein, His-tagged | +Inquiry |
| ZNF581-2845H | Recombinant Human ZNF581 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZNF581-43HCL | Recombinant Human ZNF581 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNF581 Products
Required fields are marked with *
My Review for All ZNF581 Products
Required fields are marked with *
