Recombinant Human ZNF645 protein, GST-tagged

Cat.No. : ZNF645-301285H
Product Overview : Recombinant Human ZNF645 (287-425 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Ser287-Tyr425
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : SPSSPVNHQMPYPPQDVVTPNSVRSQVPALTTTYDPSSGYIIVKVPPDMNSPPLRAPQSQNGNPSASEFASHHYNLNILPQFTENQETLSPQFTQTDAMDHRRWPAWKRLSPCPPTRSPPPSTLHGRSHHSHQRRHRRY
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name ZNF645 zinc finger protein 645 [ Homo sapiens ]
Official Symbol ZNF645
Synonyms ZNF645; zinc finger protein 645; E3 ubiquitin-protein ligase ZNF645; FLJ25735; HAKAIL; E3 ubiquitin ligase;
Gene ID 158506
mRNA Refseq NM_152577
Protein Refseq NP_689790
UniProt ID Q8N7E2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZNF645 Products

Required fields are marked with *

My Review for All ZNF645 Products

Required fields are marked with *

0
cart-icon
0
compare icon