Recombinant Human ZNF645 protein, GST-tagged
Cat.No. : | ZNF645-301285H |
Product Overview : | Recombinant Human ZNF645 (287-425 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ser287-Tyr425 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | SPSSPVNHQMPYPPQDVVTPNSVRSQVPALTTTYDPSSGYIIVKVPPDMNSPPLRAPQSQNGNPSASEFASHHYNLNILPQFTENQETLSPQFTQTDAMDHRRWPAWKRLSPCPPTRSPPPSTLHGRSHHSHQRRHRRY |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | ZNF645 zinc finger protein 645 [ Homo sapiens ] |
Official Symbol | ZNF645 |
Synonyms | ZNF645; zinc finger protein 645; E3 ubiquitin-protein ligase ZNF645; FLJ25735; HAKAIL; E3 ubiquitin ligase; |
Gene ID | 158506 |
mRNA Refseq | NM_152577 |
Protein Refseq | NP_689790 |
UniProt ID | Q8N7E2 |
◆ Recombinant Proteins | ||
ZNF645-301285H | Recombinant Human ZNF645 protein, GST-tagged | +Inquiry |
ZNF645-851C | Recombinant Cynomolgus Monkey ZNF645 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZNF645-1108C | Recombinant Cynomolgus ZNF645 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZNF645 Products
Required fields are marked with *
My Review for All ZNF645 Products
Required fields are marked with *
0
Inquiry Basket