Recombinant Human ZNF706 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ZNF706-930H |
| Product Overview : | ZNF706 MS Standard C13 and N15-labeled recombinant protein (NP_001035975) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | ZNF706 (Zinc Finger Protein 706) is a Protein Coding gene. Among its related pathways are Gene Expression. |
| Molecular Mass : | 8.5 kDa |
| AA Sequence : | MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPELADVQASGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ZNF706 zinc finger protein 706 [ Homo sapiens (human) ] |
| Official Symbol | ZNF706 |
| Synonyms | ZNF706; zinc finger protein 706; HSPC038; PNAS-106; PNAS-113; |
| Gene ID | 51123 |
| mRNA Refseq | NM_001042510 |
| Protein Refseq | NP_001035975 |
| UniProt ID | Q9Y5V0 |
| ◆ Recombinant Proteins | ||
| ZNF706-2439H | Recombinant Human ZNF706 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ZNF706-7843Z | Recombinant Zebrafish ZNF706 | +Inquiry |
| Zfp706-7097M | Recombinant Mouse Zfp706 Protein, Myc/DDK-tagged | +Inquiry |
| ZNF706-7842Z | Recombinant Zebrafish ZNF706 | +Inquiry |
| ZNF706-7844Z | Recombinant Zebrafish ZNF706 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZNF706-20HCL | Recombinant Human ZNF706 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNF706 Products
Required fields are marked with *
My Review for All ZNF706 Products
Required fields are marked with *
