"ZNF746" Related Products

Recombinant Human ZNF746 protein, T7-tagged

Cat.No.: ZNF746-141H
Product Overview: Recombinant human ZNF746 protein fused with T7 tag at N-terminal, was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: AEAVAAPISPWTMAATIQAMERKIESQAARLLSLEGRTGMAEKKLADCEKTAVEFGNQLEGKWAVLGTLLQEYGL LQRRLENVENLLRNRNFWILRLPPGSKGESPKEWGKLEDWQKELYKHVMRGNYETLVSLDYAISKPEVLSQIEQG KEPCNWRRPGPKIPDVPVDPSPGSGPPVPAPDLLMQIKQEGELQLQEQQALGVEAWAAGQPDIGEEPWGLSQLDS GAGDISTDATSGVHSNFSTTIPPTSWQTDLPPHHPSSACSDGTLKLNTAASTEDVKIVIKTEVQEEEVVATPVHP TDLEAHGTLFGPGQATRFFPSPAQEGAWESQGSSFPSQDPVLGLREPARPERDMGELSPAVAQEETPPGDWLFGG VRWGWNFRCKPPVGLNPRTGPEGLPYSSPDNGEAILDPSQAPRPFNEPCKYPGRTKGFGHKPGLKKHPAAPPGGR PFTCATCGKSFQLQVSLSAHQRSCGAPDGSGPGTGGGGSGSGGGGGGSGGGSARDGSALRCGECGRCFTRPAHLI RHRMLHTGERPFPCTECEKRFTERSKLIDHYRTHTGVRPFTCTVCGKSFIRKDHLRKHQRNHAAGAKTPARGQPL PTPPAPPDPFKSPASKGPLASTDLVTDWTCGLSVLGPTDGGDM
Purity: >90% by SDS-PAGE
Applications: 1. Protein transduction for gene transcription regulation study in vitro.2. Active recombinant protein, may be used for ELISA based DNA / protein binding assay.3. As specific protein substrate for E3 ubiquitin ligase (parkin).4. As immunogen for specific antibody production.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: ZNF746 zinc finger protein 746 [ Homo sapiens ]
Official Symbol: ZNF746
Synonyms: PARIS; parkin interacting substrate; parkin-interacting substrate; parkin-interacting sustrate
Gene ID: 155061
mRNA Refseq: NM_001163474
Protein Refseq: NP_001156946
MIM: 613914
UniProt ID: Q6NUN9
Chromosome Location: 7q36.1
Pathway: Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.