Recombinant Human ZNF839 protein, His-tagged

• Cat.No.: ZNF839-3878H
• Product Overview: Recombinant Human ZNF839 protein(NP_060805)(514-643 aa), fused with His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 514-643 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: FPAIYKEFEELHKMVKKMCQDYLSSSGLCSQETLEINNDKVAESLGITEFLRKKEIHPDNLGPKHLSRDMDGEQLEGASSEKREREAAEEGLASVKRPRREALSNDTTESLAANSRGREKPRPLHALAAG
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ZNF839 zinc finger protein 839 [ Homo sapiens ]
• Official Symbol: ZNF839
• Synonyms: ZNF839; zinc finger protein 839; C14orf131, chromosome 14 open reading frame 131; renal carcinoma antigen NY-REN-50; C14orf131; FLJ11132
• Gene ID: 55778
• mRNA Refseq: NM_018335
• Protein Refseq: NP_060805
• UniProt ID: A8K0R7