Recombinant Human ZNRF1 Protein, His-tagged
Cat.No. : | ZNRF1-443H |
Product Overview : | Recombinant Human ZNRF1 fused with His tag at N, C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes an E3 ubiquitin-protein ligase that plays a role in neural-cell differentiation. Overexpression of this gene causes neurite-like elongation. The encoded protein contains both a zinc finger and a RING finger motif and is localized in the endosome/lysosome compartment, indicating that it may be involved in ubiquitin-mediated protein modification, and in synaptic vessicle membranes in neurons. |
Form : | Supplied as a 0.2 µm filtered solution of 20mM Tris, 0.15M NaCl, 1mM EDTA, 10%glycerol, pH 8.0 |
Molecular Mass : | 14kD |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTLEHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | ZNRF1 zinc and ring finger 1, E3 ubiquitin protein ligase [ Homo sapiens ] |
Official Symbol | ZNRF1 |
Synonyms | ZNRF1; zinc and ring finger 1, E3 ubiquitin protein ligase; zinc and ring finger 1; E3 ubiquitin-protein ligase ZNRF1; DKFZp434E229; FLJ14846; nin283; nerve injury gene 283; zinc/RING finger protein 1; zinc and ring finger protein 1; nerve injury-induced gene 283 protein; NIN283; FLJ46491; MGC15430; |
Gene ID | 84937 |
mRNA Refseq | NM_032268 |
Protein Refseq | NP_115644 |
MIM | 612060 |
UniProt ID | Q8ND25 |
◆ Recombinant Proteins | ||
ZNRF1-10491M | Recombinant Mouse ZNRF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZNRF1-443H | Recombinant Human ZNRF1 Protein, His-tagged | +Inquiry |
ZNRF1-19219M | Recombinant Mouse ZNRF1 Protein | +Inquiry |
ZNRF1-11118Z | Recombinant Zebrafish ZNRF1 | +Inquiry |
ZNRF1-134H | Recombinant Human ZNRF1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNRF1-2097HCL | Recombinant Human ZNRF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNRF1 Products
Required fields are marked with *
My Review for All ZNRF1 Products
Required fields are marked with *
0
Inquiry Basket