Recombinant Human ZNRF1 Protein, His-tagged

Cat.No. : ZNRF1-443H
Product Overview : Recombinant Human ZNRF1 fused with His tag at N, C-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes an E3 ubiquitin-protein ligase that plays a role in neural-cell differentiation. Overexpression of this gene causes neurite-like elongation. The encoded protein contains both a zinc finger and a RING finger motif and is localized in the endosome/lysosome compartment, indicating that it may be involved in ubiquitin-mediated protein modification, and in synaptic vessicle membranes in neurons.
Form : Supplied as a 0.2 µm filtered solution of 20mM Tris, 0.15M NaCl, 1mM EDTA, 10%glycerol, pH 8.0
Molecular Mass : 14kD
AA Sequence : MGSSHHHHHHSSGLVPRGSHMPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTLEHHHHHH
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name ZNRF1 zinc and ring finger 1, E3 ubiquitin protein ligase [ Homo sapiens ]
Official Symbol ZNRF1
Synonyms ZNRF1; zinc and ring finger 1, E3 ubiquitin protein ligase; zinc and ring finger 1; E3 ubiquitin-protein ligase ZNRF1; DKFZp434E229; FLJ14846; nin283; nerve injury gene 283; zinc/RING finger protein 1; zinc and ring finger protein 1; nerve injury-induced gene 283 protein; NIN283; FLJ46491; MGC15430;
Gene ID 84937
mRNA Refseq NM_032268
Protein Refseq NP_115644
MIM 612060
UniProt ID Q8ND25

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZNRF1 Products

Required fields are marked with *

My Review for All ZNRF1 Products

Required fields are marked with *

0
cart-icon