Recombinant Human ZNRF1 Protein, His-tagged

• Cat.No.: ZNRF1-443H
• Product Overview: Recombinant Human ZNRF1 fused with His tag at N, C-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: This gene encodes an E3 ubiquitin-protein ligase that plays a role in neural-cell differentiation. Overexpression of this gene causes neurite-like elongation. The encoded protein contains both a zinc finger and a RING finger motif and is localized in the endosome/lysosome compartment, indicating that it may be involved in ubiquitin-mediated protein modification, and in synaptic vessicle membranes in neurons.
• Form: Supplied as a 0.2 µm filtered solution of 20mM Tris, 0.15M NaCl, 1mM EDTA, 10%glycerol, pH 8.0
• Molecular Mass: 14kD
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTLEHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining

Gene Information

• Gene Name: ZNRF1 zinc and ring finger 1, E3 ubiquitin protein ligase [ Homo sapiens ]
• Official Symbol: ZNRF1
• Synonyms: ZNRF1; zinc and ring finger 1, E3 ubiquitin protein ligase; zinc and ring finger 1; E3 ubiquitin-protein ligase ZNRF1; DKFZp434E229; FLJ14846; nin283; nerve injury gene 283; zinc/RING finger protein 1; zinc and ring finger protein 1; nerve injury-induced gene 283 protein; NIN283; FLJ46491; MGC15430
• Gene ID: 84937
• mRNA Refseq: NM_032268
• Protein Refseq: NP_115644
• MIM: 612060
• UniProt ID: Q8ND25