Recombinant Human ZNRF3 protein
| Cat.No. : | ZNRF3-4636H |
| Product Overview : | Recombinant Human ZNRF3 protein(Q9ULT6)(56-219aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 56-219aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 18.2 kDa |
| AA Sequence : | KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | ZNRF3 zinc and ring finger 3 [ Homo sapiens ] |
| Official Symbol | ZNRF3 |
| Synonyms | RNF203; BK747E2.3 |
| Gene ID | 84133 |
| mRNA Refseq | NM_032173.3 |
| Protein Refseq | NP_115549.2 |
| MIM | 612062 |
| UniProt ID | Q9ULT6 |
| ◆ Recombinant Proteins | ||
| ZNRF3-10493M | Recombinant Mouse ZNRF3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ZNRF3-19221M | Recombinant Mouse ZNRF3 Protein | +Inquiry |
| ZNRF3-1524H | Recombinant Human ZNRF3 protein, His-tagged | +Inquiry |
| ZNRF3-2111H | Active Recombinant Human ZNRF3 protein, His-tagged | +Inquiry |
| ZNRF3-1523H | Recombinant Human ZNRF3 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNRF3 Products
Required fields are marked with *
My Review for All ZNRF3 Products
Required fields are marked with *
