Recombinant Human ZNRF3 protein
Cat.No. : | ZNRF3-4636H |
Product Overview : | Recombinant Human ZNRF3 protein(Q9ULT6)(56-219aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 56-219aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.2 kDa |
AA Sequence : | KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | ZNRF3 zinc and ring finger 3 [ Homo sapiens ] |
Official Symbol | ZNRF3 |
Synonyms | RNF203; BK747E2.3 |
Gene ID | 84133 |
mRNA Refseq | NM_032173.3 |
Protein Refseq | NP_115549.2 |
MIM | 612062 |
UniProt ID | Q9ULT6 |
◆ Recombinant Proteins | ||
ZNRF3-1910H | Recombinant Human ZNRF3 Protein (56-219 aa), His-SUMO-tagged | +Inquiry |
ZNRF3-19221M | Recombinant Mouse ZNRF3 Protein | +Inquiry |
ZNRF3-10493M | Recombinant Mouse ZNRF3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZNRF3-2111H | Active Recombinant Human ZNRF3 protein, His-tagged | +Inquiry |
Znrf3-33M | Active Recombinant Mouse zinc and ring finger 3 protein, Fc tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNRF3 Products
Required fields are marked with *
My Review for All ZNRF3 Products
Required fields are marked with *
0
Inquiry Basket