Recombinant Human ZRANB1 protein, His-tagged
| Cat.No. : | ZRANB1-3700H |
| Product Overview : | Recombinant Human ZRANB1 protein(1-100 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | December 07, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-100 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MSERGIKWACEYCTYENWPSAIKCTMCRAQRPSGTIITEDPFKSGSSDVGRDWDPSSTEGGSSPLICPDSSARPRVKSSYSMENANKWSCHMCTYLNWPR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | ZRANB1 zinc finger, RAN-binding domain containing 1 [ Homo sapiens ] |
| Official Symbol | ZRANB1 |
| Synonyms | ZRANB1; zinc finger, RAN-binding domain containing 1; ubiquitin thioesterase ZRANB1; TRABID; hTrabid; TRAF-binding protein domain; TRAF-binding domain-containing protein; zinc finger Ran-binding domain-containing protein 1; DKFZp762P2216; |
| Gene ID | 54764 |
| mRNA Refseq | NM_017580 |
| Protein Refseq | NP_060050 |
| MIM | 611749 |
| UniProt ID | Q9UGI0 |
| ◆ Recombinant Proteins | ||
| ZRANB1-19230M | Recombinant Mouse ZRANB1 Protein | +Inquiry |
| ZRANB1-1331S | Recombinant Human ZRANB1 Protein (M1-E708), Tag Free | +Inquiry |
| ZRANB1-3700H | Recombinant Human ZRANB1 protein, His-tagged | +Inquiry |
| ZRANB1-158H | Active Recombinant Human ZRANB1, His-tagged | +Inquiry |
| ZRANB1-6422H | Recombinant Human ZRANB1 protein, His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZRANB1 Products
Required fields are marked with *
My Review for All ZRANB1 Products
Required fields are marked with *
