Recombinant Human ZSCAN2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ZSCAN2-1693H
Product Overview : ZSCAN2 MS Standard C13 and N15-labeled recombinant protein (NP_001007073) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene contains several copies of zinc finger motif, which is commonly found in transcriptional regulatory proteins. Studies in mice show that this gene is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells. Alternative splicing of this gene results in several transcript variants encoding different isoforms.
Molecular Mass : 16.2 kDa
AA Sequence : MMAADIPRVTTPLSSLVQVPQEEDRQEEEVTTMILEDDSWVQEAVLQEDGPESEPFPQSAGKGGPQEEVTRGPQGALGRLRELCRRWLRPEVHTKEQMLTMLPKEIQAWLQEHRPESSEEAAALVEDLTQTLQDSETASCVHGCPVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ZSCAN2 zinc finger and SCAN domain containing 2 [ Homo sapiens (human) ]
Official Symbol ZSCAN2
Synonyms ZSCAN2; zinc finger and SCAN domain containing 2; ZFP29; ZNF854; zinc finger and SCAN domain-containing protein 2; zfp-29; zinc finger protein 29 homolog; zinc finger protein 854
Gene ID 54993
mRNA Refseq NM_001007072
Protein Refseq NP_001007073
UniProt ID Q7Z7L9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZSCAN2 Products

Required fields are marked with *

My Review for All ZSCAN2 Products

Required fields are marked with *

0
cart-icon