Recombinant Human ZSCAN2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ZSCAN2-1693H |
Product Overview : | ZSCAN2 MS Standard C13 and N15-labeled recombinant protein (NP_001007073) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene contains several copies of zinc finger motif, which is commonly found in transcriptional regulatory proteins. Studies in mice show that this gene is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells. Alternative splicing of this gene results in several transcript variants encoding different isoforms. |
Molecular Mass : | 16.2 kDa |
AA Sequence : | MMAADIPRVTTPLSSLVQVPQEEDRQEEEVTTMILEDDSWVQEAVLQEDGPESEPFPQSAGKGGPQEEVTRGPQGALGRLRELCRRWLRPEVHTKEQMLTMLPKEIQAWLQEHRPESSEEAAALVEDLTQTLQDSETASCVHGCPVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ZSCAN2 zinc finger and SCAN domain containing 2 [ Homo sapiens (human) ] |
Official Symbol | ZSCAN2 |
Synonyms | ZSCAN2; zinc finger and SCAN domain containing 2; ZFP29; ZNF854; zinc finger and SCAN domain-containing protein 2; zfp-29; zinc finger protein 29 homolog; zinc finger protein 854 |
Gene ID | 54993 |
mRNA Refseq | NM_001007072 |
Protein Refseq | NP_001007073 |
UniProt ID | Q7Z7L9 |
◆ Recombinant Proteins | ||
ZSCAN2-10500M | Recombinant Mouse ZSCAN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZSCAN2-19237M | Recombinant Mouse ZSCAN2 Protein | +Inquiry |
Zscan2-7128M | Recombinant Mouse Zscan2 Protein, Myc/DDK-tagged | +Inquiry |
ZSCAN2-1693H | Recombinant Human ZSCAN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ZSCAN2-837H | Recombinant Human ZSCAN2 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZSCAN2 Products
Required fields are marked with *
My Review for All ZSCAN2 Products
Required fields are marked with *