Recombinant Human ZWINT Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ZWINT-4887H |
Product Overview : | ZWINT MS Standard C13 and N15-labeled recombinant protein (NP_127490) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein that is clearly involved in kinetochore function although an exact role is not known. It interacts with ZW10, another kinetochore protein, possibly regulating the association between ZW10 and kinetochores. The encoded protein localizes to prophase kinetochores before ZW10 does and it remains detectable on the kinetochore until late anaphase. It has a uniform distribution in the cytoplasm of interphase cells. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 31.2 kDa |
AA Sequence : | MEAAETEAEAAALEVLAEVAGILEPVGLQEEAELPAKILVEFVVDSQKKDKLLCSQLQVADFLQNILAQEDTAKGLDPLASEDTSRQKAIAAKEQWKELKATYREHVEAIKIGLTKALTQMEEAQRKRTQLREAFEQLQAKKQMAMEKRRAVQNQWQLQQEKHLQHLAEVSAEVRERKTGTQQELDGVFQKLGNLKQQAEQERDKLQRYQTFLQLLYTLQGKLLFPEAEAEAENLPDDKPQQPTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDVNLPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ZWINT ZW10 interactor [ Homo sapiens (human) ] |
Official Symbol | ZWINT |
Synonyms | ZWINT; ZW10 interactor; KNTC2AP; zwint-1; ZW10-interacting protein 1; human ZW10 interacting protein-1; ZWINT1; HZwint-1; MGC117174; |
Gene ID | 11130 |
mRNA Refseq | NM_032997 |
Protein Refseq | NP_127490 |
MIM | 609177 |
UniProt ID | O95229 |
◆ Recombinant Proteins | ||
ZWINT-19258M | Recombinant Mouse ZWINT Protein | +Inquiry |
ZWINT-608H | Recombinant Human ZWINT Protein, His-tagged | +Inquiry |
ZWINT-153H | Recombinant Human ZWINT, His-tagged | +Inquiry |
ZWINT-458H | Recombinant Human ZWINT Protein, His-tagged | +Inquiry |
ZWINT-6721R | Recombinant Rat ZWINT Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZWINT-9179HCL | Recombinant Human ZWINT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZWINT Products
Required fields are marked with *
My Review for All ZWINT Products
Required fields are marked with *
0
Inquiry Basket