Recombinant Influenza A virus (strain A/Bangkok/1/1979 H3N2) HA Protein, His-tagged
Cat.No. : | HA-105H |
Product Overview : | Recombinant Influenza A virus (strain A/Bangkok/1/1979 H3N2) HA Protein(P03441)(330-550aa), fused to N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Influenza A virus (strain A/Bangkok/1/1979 H3N2) |
Source : | Yeast |
Tag : | His |
Protein Length : | 330-550aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27.3kDa |
AA Sequence : | GIFGAIAGFIENGWEGMSSGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYRDEALNNRFQIKGVELKSGYKDWILWISFAISCFLLCVVLLGFIMVSCQKGNIRCNICI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Native Proteins | ||
HA-007R | Native Rooster comb Hyaluronic acid sodium salt | +Inquiry |
◆ Cell & Tissue Lysates | ||
HA-002H5N2CL | Recombinant H5N1 HA cell lysate | +Inquiry |
HA-878HCL | Recombinant H7N9 HA cell lysate | +Inquiry |
HA-2335HCL | Recombinant H2N2 HA cell lysate | +Inquiry |
HA-1588HCL | Recombinant H4N8 HA cell lysate | +Inquiry |
HA-001H3N2CL | Recombinant H3N2 HA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HA Products
Required fields are marked with *
My Review for All HA Products
Required fields are marked with *
0
Inquiry Basket