Recombinant Influenza A virus (strain A/Niigata/137/1996 H3N2) NA protein, His&Myc-tagged
Cat.No. : | NA-5432V |
Product Overview : | Recombinant Influenza A virus (strain A/Niigata/137/1996 H3N2) NA protein(O91745)(31-469aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Influenza A virus (strain A/Niigata/137/1996 H3N2) |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 31-469a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 56.2 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | TTVTLHFKQYECNSPPNNQVMLCEPTIIERNITEIVYLTNTTIEKEICPKLAEYRNWSKPQCKITGFAPFSKDNSIRLSAGGDIWVTREPYVSCDPDKCYQFALGQGTTLNNRHSNDTVHDRTPYRTLLMNELGVPFHLGTKQVCIAWSSSSCHDGKAWLHVCVTGHDENATASFIYDGRLVDSIGSWSKKILRTQESECVCINGTCTVVMTDGSASGRADTKILFIEEGKIVHISPLSGSAQHVEECSCYPRYSGVRCVCRDNWKGSNRPIVDINVKDYSIVSSYVCSGLVGDTPRKNDSSSSSHCLNPNNEEGGHGVKGWAFDDGNDVWMGRTISEKLRSGYETFKVIGGWSKPNSKLQINRQVIVDRGNRSGYSGIFSVEGKSCINRCFYVELIRGRKQETEVWWTSNSIVVFCGTSGTYGTGSWPDGADINLMPI |
◆ Cell & Tissue Lysates | ||
NA-003H9N2CL | Recombinant H9N2 NA cell lysate | +Inquiry |
NA-875HCL | Recombinant H7N9 NA cell lysate | +Inquiry |
NA-002H1N1CL | Recombinant H1N1 NA cell lysate | +Inquiry |
NA-874HCL | Recombinant H7N9 NA cell lysate | +Inquiry |
NA-022H5N1CL | Recombinant H5N1 NA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NA Products
Required fields are marked with *
My Review for All NA Products
Required fields are marked with *