Recombinant Japanese horseshoe crab Lectin protein, His-SUMO-tagged
| Cat.No. : | Lectin-4456J |
| Product Overview : | Recombinant Japanese horseshoe crab Lectin protein(Q27084)(20-255aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Japanese horseshoe crab |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 20-255aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 42.8 kDa |
| AA Sequence : | VGGESMLRGVYQDKFYQGTYPQNKNDNWLARATLIGKGGWSNFKFLFLSPGGELYGVLNDKIYKGTPPTHDNDNWMGRAKKIGNGGWNQFQFLFFDPNGYLYAVSKDKLYKASPPQSDTDNWIARATEIGSGGWSGFKFLFFHPNGYLYAVHGQQFYKALPPVSNQDNWLARATKIGQGGWDTFKFLFFSSVGTLFGVQGGKFYEDYPPSYAHDNWLARAKLIGNGGWDDFRFLFF |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| ◆ Recombinant Proteins | ||
| Lectin-4456J | Recombinant Japanese horseshoe crab Lectin protein, His-SUMO-tagged | +Inquiry |
| Lectin-1401L | Recombinant Lentil Lectin protein, His&Myc-tagged | +Inquiry |
| lectin-1031E | Recombinant European mistletoe lectin protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| Lectin-1738S | Active Native Sambucus Nigra Lectin Protein, Fluorescein labeled | +Inquiry |
| Lectin-1727W | Native Wheat Germ Lectin, Biotin conjugated | +Inquiry |
| Lectin-1743N | Active Native Narcissus Pseudonarcissus (Daffodil) Lectin Protein | +Inquiry |
| Lectin-1822P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Agarose bound | +Inquiry |
| Lectin-1729G | Active Native Griffonia Simplicifolia Lectin I Protein, Rhodamine labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Lectin Products
Required fields are marked with *
My Review for All Lectin Products
Required fields are marked with *



