Recombinant Klebsiella Oxytoca BLA Protein (25-293 aa), His-SUMO-tagged
Cat.No. : | BLA-1785K |
Product Overview : | Recombinant Klebsiella Oxytoca BLA Protein (25-293 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Klebsiella Oxytoca |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 25-293 aa |
Description : | Hydrolyzes carbapenems, penicillins, cephalosporins and aztreonam with varying efficiency. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 44.5 kDa |
AA Sequence : | LTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGVNGQ |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | bla; Carbapenem-hydrolyzing beta-lactamase KPC-2; |
UniProt ID | Q848S6 |
◆ Recombinant Proteins | ||
BLA-4524C | Recombinant Chicken BLA | +Inquiry |
bla-022S | Recombinant Salmonella typhimurium bla protein | +Inquiry |
BLA-2060P | Recombinant Pseudomonas Aeruginosa BLA Protein (21-266 aa), His-SUMO-tagged | +Inquiry |
BLA-2362E | Recombinant Escherichia coli BLA Protein (29-291 aa), His-tagged | +Inquiry |
bla-1145E | Recombinant E. coli Beta-lactamase TEM Protein, His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
BLA-01B | Native Bovine β-Lactoglobulin Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BLA Products
Required fields are marked with *
My Review for All BLA Products
Required fields are marked with *
0
Inquiry Basket