Recombinant Lachnellula hyalina MEP Protein
| Cat.No. : | MEP-31L |
| Product Overview : | Recombinant Lachnellula hyalina MEP Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Lachnellula hyalina |
| Source : | E.coli |
| Description : | Extracellular metalloproteinase mep |
| Form : | 50mM Tris, 0.3 M NaCl, 10% Glycerol, pH8.0. |
| Molecular Mass : | 19.9kDa |
| AA Sequence : | MHHHHHHENLYFQGTYNGCSSSEQSALAAAASAAQSYVAESLSYLQTHTAATPRYTTWFGSYISSRHSTVLQHYTDMNSNDFSSYSFDCTCTAAGTFAYVYPNRFGTVYLCGAFWKAPTTGTDSQAGTLVHESSHFTRNGGTKDYAYGQAAAKSLATMDPDKAVMNADNHEYFSENNPAQS |
| Purity : | >90% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.5 mg/mL |
| Gene Name | mep Extracellular metalloproteinase mep [ Lachnellula hyalina ] |
| Official Symbol | MEP |
| Gene ID | 41982318 |
| mRNA Refseq | XM_031147098 |
| Protein Refseq | XP_031007635 |
| UniProt ID | P81054 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MEP Products
Required fields are marked with *
My Review for All MEP Products
Required fields are marked with *
Recently Viewed
