Recombinant Lactobacillus plantarum ldh1 protein, GST-tagged
Cat.No. : | ldh1-4066L |
Product Overview : | Recombinant Lactobacillus plantarum ldh1 protein(P56512)(1-320aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lactobacillus plantarum |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-320aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 61.2 kDa |
AA Sequence : | MSSMPNHQKVVLVGDGAVGSSYAFAMAQQGIAEEFVIVDVVKDRTKGDALDLEDAQAFTAPKKIYSGEYSDCKDADLVVITAGAPQKPGESRLDLVNKNLNILSSIVKPVVDSGFDGIFLVAANPVDILTYATWKFSGFPKDRVIGSGTSLDSSRLRVALGKQFNVDPRSVDAYIMGEHGDSEFAAYSTATIGTRPVRDVAKEQGVSDEDLAKLEDGVRNKAYDIINLKGATFYGIGTALMRISKAILRDENAVLPVGAYMDGQYGLNDIYIGTPAVIGGTGLKQIIESPLSADELKKMQDSAATLKKVLNDGLAELENK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
LDHA-1944H | Recombinant Human Lactate dehydrogenase A, His-tagged | +Inquiry |
LDHA-1914S | Recombinant Staphylococcus Aureus LDHA Protein (1-317 aa), His-SUMO-tagged | +Inquiry |
LDHA-4429H | Recombinant Human LDHA Protein (Met1-Phe332), N-His tagged | +Inquiry |
LDHA-2307R | Recombinant Rhesus Macaque LDHA Protein, His (Fc)-Avi-tagged | +Inquiry |
LDHA-1284H | Recombinant Human LDHA Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
LDH1-16H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
LDH1-18H | Native Human Lactate Dehydrogenase 1 | +Inquiry |
LDH1-219H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
LDH1-218H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
LDHA-26867TH | Native Human LDHA | +Inquiry |
◆ Cell & Tissue Lysates | ||
LDHA-4790HCL | Recombinant Human LDHA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LDHA Products
Required fields are marked with *
My Review for All LDHA Products
Required fields are marked with *
0
Inquiry Basket