Recombinant Laribacter Hongkongensis PYRE Protein (1-213 aa), His-SUMO-tagged
| Cat.No. : | PYRE-1908L |
| Product Overview : | Recombinant Laribacter Hongkongensis (strain HLHK9) PYRE Protein (1-213 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Laribacter Hongkongensis |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-213 aa |
| Description : | Catalyzes the transfer of a ribosyl phosphate group from 5-phosphoribose 1-diphosphate to orotate, leading to the formation of orotidine monophosphate (OMP). |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 38.9 kDa |
| AA Sequence : | MSDFRQDFIRFAVEEQVLRFGEFVTKAGRPSPYFFNAGLFNHGASLLSLARFYARSISESGIAFDMLFGPAYKGIVLAGATAMMLAEQGRDVPFAFNRKEAKDHGEGGTLIGAPLKGRVLIIDDVISAGTSVRESVEIIRANGAEPAGVAIALDRMERGQGELSATQEVAQKFGLPVVAIASLDDLLGFLAGSPDLADNLTRVEAYRTQYGVR |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Synonyms | pyrE; Short name:OPRT Short name:OPRTase; |
| UniProt ID | C1D6F5 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PYRE Products
Required fields are marked with *
My Review for All PYRE Products
Required fields are marked with *



