Recombinant Legionella longbeachae mip protein, His&Myc-tagged
Cat.No. : | mip-4392L |
Product Overview : | Recombinant Legionella longbeachae mip protein(P53605)(21-233aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Legionella longbeachae |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 21-233aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.1 kDa |
AA Sequence : | ATDATSLTTDKDKLSYSIGADLGKNFKNQGIDINPDVLAKGMQDGMSGAQLILTEEQMKDVLSKFQKDLMAKRSAEFNKKAEENKAKGDAFLSANKSKPGIVVLPSGLQYKIIDAGTGAKPGKSDTVTVEYTGTLIDGTVFDSTEKAGKPATFQVSQVIPGWTEALQLMPAGSTWEVFVPADLAYGPRSVGGPIGPNETLIFKIHLISVKKAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
MIP-6267HF | Recombinant Full Length Human MIP Protein | +Inquiry |
RFL17041OF | Recombinant Full Length Rabbit Lens Fiber Major Intrinsic Protein(Mip) Protein, His-Tagged | +Inquiry |
MIP-886H | Recombinant Human MIP, GST-tagged | +Inquiry |
RFL26329GF | Recombinant Full Length Chicken Lens Fiber Major Intrinsic Protein(Mip) Protein, His-Tagged | +Inquiry |
MIP-9850M | Recombinant Mouse MIP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MIP-410HCL | Recombinant Human MIP lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mip Products
Required fields are marked with *
My Review for All mip Products
Required fields are marked with *
0
Inquiry Basket