Recombinant Lolium Perenne LOLPIB Protein (26-307 aa), His-SUMO-Myc-tagged

• Cat.No.: LOLPIB-2158L
• Product Overview: Recombinant Lolium Perenne (Perennial ryegrass) LOLPIB Protein (26-307 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Allergen. Protein Description: Full Length of Mature Protein.

Specification

• Species: Lolium Perenne
• Source: E.coli
• Tag: His&Myc&SUMO
• Protein Length: 26-307 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 48.4 kDa
• AA Sequence: ADAGYTPAAAATPATPAATPAAAGGKATTDEQKLLEDVNAGFKAAVAAAANAPPADKFKIFEAAFSESSKGLLATSAAKAPGLIPKLDTAYDVAYKAAEATPEAKYDAFVTALTEALRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAYETYKFIPSLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAAVLPPPLLVVQSLISLLIYY
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Synonyms: LOLPIB; Allergen Lol p Ib Allergen Lol p Va Allergen: Lol p 5a
• UniProt ID: Q40240