Recombinant Methanothermobacter thermautotrophicus Thymine/uracil-DNA glycosylase, Full Length, C-His tagged

• Cat.No.: TDG-02M
• Product Overview: Recombinant Methanothermobacter thermautotrophicus Thymine/uracil-DNA glycosylase (Full Length) with C-His tag was expressed in E. coli.

Specification

• Species: Methanothermobacter thermautotrophicus
• Source: E.coli
• Tag: His
• Protein Length: Full Length
• Molecular Mass: 26.5 kDa
• AA Sequence: MDDATNKKRKVFVSTILTFWNTDRRDFPWRHTRDPYVILITEILLRRTTAGHVKKIYDKFFVKYKCFEDILKTPKSEIAKDIKEIGLSNQRAEQLKELARVVINDYGGRVPRNRKAILDLPGVGKYTCAAVMCLAFGKKAAMVDANFVRVINRYFGGSYENLNYNHKALWELAETLVPGGKCRDFNLGLMDFSAIICAPRKPKCEKCGMSKLCSYYEKCSTLEHHHHHH
• Purity: > 90% as determined by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.2 mg/mL
• Storage Buffer: 50mM Tris, 300mM NaCl, pH8.0

Gene Information

• Official Symbol: TDG
• Synonyms: TDG; thermautotrophicus Thymine/uracil-DNA glycosylase