Recombinant Methanothermobacter thermautotrophicus Thymine/uracil-DNA glycosylase, Full Length, C-His tagged

Cat.No. : TDG-02M
Product Overview : Recombinant Methanothermobacter thermautotrophicus Thymine/uracil-DNA glycosylase (Full Length) with C-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Methanothermobacter thermautotrophicus
Source : E.coli
Tag : His
Protein Length : Full Length
Molecular Mass : 26.5 kDa
AA Sequence : MDDATNKKRKVFVSTILTFWNTDRRDFPWRHTRDPYVILITEILLRRTTAGHVKKIYDKFFVKYKCFEDILKTPKSEIAKDIKEIGLSNQRAEQLKELARVVINDYGGRVPRNRKAILDLPGVGKYTCAAVMCLAFGKKAAMVDANFVRVINRYFGGSYENLNYNHKALWELAETLVPGGKCRDFNLGLMDFSAIICAPRKPKCEKCGMSKLCSYYEKCSTLEHHHHHH
Purity : > 90% as determined by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.2 mg/mL
Storage Buffer : 50mM Tris, 300mM NaCl, pH8.0
Official Symbol TDG
Synonyms TDG; thermautotrophicus Thymine/uracil-DNA glycosylase

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TDG Products

Required fields are marked with *

My Review for All TDG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon