Recombinant Monkeypox virus b6r Protein, His-tagged
| Cat.No. : | B6R-01M |
| Product Overview : | Recombinant Monkeypox virus B6R protein with a His-tag was expressed in HEK293 |
| Availability | June 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | MPX |
| Source : | HEK293 |
| Tag : | His |
| Description : | Monkeypox virus (MPXV), a DNA virus, is the aetiological agent of a zoonotic disease known as monkeypox (MPX) and is grouped into two genetic clades, namely West Africa (WA) clade and Congo Basin (CB) clade. MPX has an incubation period of 4–21 days and the symptoms range from fever to respiratory distress, which are similar to symptoms of smallpox except for lymphadenopathy. |
| Molecular Mass : | The protein has a calculated MW of 29.6 kDa. |
| AA Sequence : | TCTVPTMNNAKLTSTETSFNDKQKVTFTCDSGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGVSYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYHHHHHHH |
| Endotoxin : | <1 EU/μg |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Lyophilized from PBS, pH7.4, 5% trehalose, 5% mannitol |
| Official Symbol | B6R |
| Synonyms | B6R |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B6R Products
Required fields are marked with *
My Review for All B6R Products
Required fields are marked with *
