Recombinant Moraxella catarrhalis MCR_0076 Protein

• Cat.No.: MCR_0076-80M
• Product Overview: Recombinant Moraxella catarrhalis MCR_0076 Protein was expressed in E. coli.

Specification

• Species: Moraxella catarrhalis
• Source: E.coli
• Description: TonB-dependent receptor
• Form: Liquid. In 50 mM NaH2PO4 buffer (pH8.0) containing 300 mM NaCl.
• Molecular Mass: ~16.8 kDa
• AA Sequence: DNTKLGEEPTTTLKGVLVSSQTNQNTGFVSNDSKQSSDLTLSKDKLKYRSATLGNALSGELGIHSNPFGGGSSAPVVRGQEGVRLKILQNGTDVIDVSSISPDHVVATDTLLASKVELVRGADTLLYGLASPAGVINVVD
• Purity: >85%
• Storage: Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
• Concentration: 0.75 mg/ml

Gene Information

• Official Symbol: MCR_0076
• UniProt ID: D5V9J7