Recombinant Moraxella catarrhalis MCR_0172 Protein

• Cat.No.: MCR_0172-85M
• Product Overview: Recombinant Moraxella catarrhalis MCR_0172 Protein was expressed in E. coli.

Specification

• Species: Moraxella catarrhalis
• Source: E.coli
• Description: Uncharacterized protein
• Form: Liquid. In 50 mM NaH2PO4 buffer (pH8.0) containing 300 mM NaCl.
• Molecular Mass: ~ 15.4 kDa
• AA Sequence: ACSPQSPTVAEHQPQQQEPLQYTNAEAQALQEQAAALQAQAAELEMQAQEAQADASHETKATSADGSGVGSLLAGAAAGAAAGYVASKVAGNRVATAQASQTAQTPTTTQQPAQNNQQATNSNRQSLAQATQDNRAGTTRQGFGATGGATGSAS
• Purity: >85%
• Storage: Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
• Concentration: 0.6 mg/ml

Gene Information

• Official Symbol: MCR_0172
• UniProt ID: D5V9U1