Recombinant Moraxella catarrhalis ssb Protein
| Cat.No. : | ssb-30M |
| Product Overview : | Recombinant Moraxella catarrhalis ssb Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Moraxella catarrhalis |
| Source : | E.coli |
| Description : | single-stranded DNA-binding protein |
| Form : | Liquid. In 50 mM NaH2PO4 buffer (pH8.0) containing 300 mM NaCl. |
| Molecular Mass : | ~28 kDa |
| AA Sequence : | MSVNKVILVGNLGNDPEVRNFDNGGMIATVSIATSERWTDRNTGERKEHTEWHRVVFNNRLAEIASQYLRKGSQIYVEGSLRTRKWQDTQTGQERYTTEIRADNMQMLGNRASGDNGGYANSQGGYANPNQQYQNQGNQGGQYPNTAYQQANQFGGQNSSGYTQPQPNQAYPNSDYPQERASQPQSSSMAQNHAFGQPTHIEQNTGMSPIQKPNTPSTNQPVITPSQGLSDDDMPF |
| Purity : | >90% |
| Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
| Concentration : | 1.0 mg/ml |
| Official Full Name : | Single-stranded DNA-binding protein |
| Gene Name | ssb single-stranded DNA-binding protein [ Moraxella catarrhalis BBH18 ] |
| Official Symbol | ssb |
| Gene ID | 9134858 |
| Protein Refseq | WP_013107673 |
| UniProt ID | D5V9T9 |
| ◆ Recombinant Proteins | ||
| Ssb-6139M | Recombinant Mouse Ssb Protein, Myc/DDK-tagged | +Inquiry |
| SSB-864HFL | Recombinant Full Length Human SSB Protein, C-Flag-tagged | +Inquiry |
| SSB-8740M | Recombinant Mouse SSB Protein, His (Fc)-Avi-tagged | +Inquiry |
| SSB-150H | Recombinant Human SSB | +Inquiry |
| Ssb-86E | Recombinant E. coli SSB | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SSB-1466HCL | Recombinant Human SSB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ssb Products
Required fields are marked with *
My Review for All ssb Products
Required fields are marked with *
