Recombinant Moraxella catarrhalis ssb Protein

Cat.No. : ssb-30M
Product Overview : Recombinant Moraxella catarrhalis ssb Protein was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Moraxella catarrhalis
Source : E.coli
Description : single-stranded DNA-binding protein
Form : Liquid. In 50 mM NaH2PO4 buffer (pH8.0) containing 300 mM NaCl.
Molecular Mass : ~28 kDa
AA Sequence : MSVNKVILVGNLGNDPEVRNFDNGGMIATVSIATSERWTDRNTGERKEHTEWHRVVFNNRLAEIASQYLRKGSQIYVEGSLRTRKWQDTQTGQERYTTEIRADNMQMLGNRASGDNGGYANSQGGYANPNQQYQNQGNQGGQYPNTAYQQANQFGGQNSSGYTQPQPNQAYPNSDYPQERASQPQSSSMAQNHAFGQPTHIEQNTGMSPIQKPNTPSTNQPVITPSQGLSDDDMPF
Purity : >90%
Storage : Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
Concentration : 1.0 mg/ml
Official Full Name : Single-stranded DNA-binding protein
Gene Name ssb single-stranded DNA-binding protein [ Moraxella catarrhalis BBH18 ]
Official Symbol ssb
Gene ID 9134858
Protein Refseq WP_013107673
UniProt ID D5V9T9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ssb Products

Required fields are marked with *

My Review for All ssb Products

Required fields are marked with *

0

Inquiry Basket

cartIcon