Recombinant Moraxella catarrhalis ssb Protein
Cat.No. : | ssb-30M |
Product Overview : | Recombinant Moraxella catarrhalis ssb Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Moraxella catarrhalis |
Source : | E.coli |
Description : | single-stranded DNA-binding protein |
Form : | Liquid. In 50 mM NaH2PO4 buffer (pH8.0) containing 300 mM NaCl. |
Molecular Mass : | ~28 kDa |
AA Sequence : | MSVNKVILVGNLGNDPEVRNFDNGGMIATVSIATSERWTDRNTGERKEHTEWHRVVFNNRLAEIASQYLRKGSQIYVEGSLRTRKWQDTQTGQERYTTEIRADNMQMLGNRASGDNGGYANSQGGYANPNQQYQNQGNQGGQYPNTAYQQANQFGGQNSSGYTQPQPNQAYPNSDYPQERASQPQSSSMAQNHAFGQPTHIEQNTGMSPIQKPNTPSTNQPVITPSQGLSDDDMPF |
Purity : | >90% |
Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 1.0 mg/ml |
Official Full Name : | Single-stranded DNA-binding protein |
Gene Name | ssb single-stranded DNA-binding protein [ Moraxella catarrhalis BBH18 ] |
Official Symbol | ssb |
Gene ID | 9134858 |
Protein Refseq | WP_013107673 |
UniProt ID | D5V9T9 |
◆ Recombinant Proteins | ||
SSB-2737H | Recombinant Human SSB Protein, His-tagged | +Inquiry |
SSB-4271B | Recombinant Bacteriophage T7 SSB protein, His-SUMO-tagged | +Inquiry |
SSB-3531H | Recombinant Human SSB protein, His-SUMO-tagged | +Inquiry |
SSB-30034TH | Recombinant Human SSB, His-tagged | +Inquiry |
SSB-9952Z | Recombinant Zebrafish SSB | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSB-1466HCL | Recombinant Human SSB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ssb Products
Required fields are marked with *
My Review for All ssb Products
Required fields are marked with *