Recombinant Mouse ADAM12 Protein (206-706 aa), His-Myc-tagged
| Cat.No. : | ADAM12-2594M |
| Product Overview : | Recombinant Mouse ADAM12 Protein (206-706 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Cancer. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 206-706 aa |
| Description : | Involved in skeletal muscle regeneration, specifically at the onset of cell fusion. Also involved in macrophage-derived giant cells (MGC) and osteoclast formation from mononuclear precursors. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 61.4 kDa |
| AA Sequence : | ETLKMTKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDIDKCSISQDPFTSLHEFLDWRKIKLLPRKSHDNAQLISGVYFQGTTIGMAPIMSMCTAEQSGGVVMDHSDSPLGAAVTLAHELGHNFGMNHDTLERGCSCRMAAEKGGCIMNPSTGFPFPMVFSSCSRKDLEASLEKGMGMCLFNLPEVKQAFGGRKCGNGYVEEGEECDCGEPEECTNRCCNATTCTLKPDAVCAHGQCCEDCQLKPPGTACRGSSNSCDLPEFCTGTAPHCPANVYLHDGHPCQGVDGYCYNGICQTHEQQCVTLWGPGAKPAPGICFERVNSAGDPYGNCGKDSKSAFAKCELRDAKCGKIQCQGGASRPVIGTNAVSIETNIPQQEGGRILCRGTHVYLGDDMPDPGLVLAGTKCAEGKICLNRRCQNISVFGVHKCAMQCHGRGVCNNRKNCHCEAHWAPPFCDKFGFGGSTDSGPIRQADNQG |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | Adam12 a disintegrin and metallopeptidase domain 12 (meltrin alpha) [ Mus musculus ] |
| Official Symbol | ADAM12 |
| Synonyms | ADAM12; ADAM 12; meltrin alpha; meltrin-alpha; Mltna; mKIAA4001; |
| Gene ID | 11489 |
| mRNA Refseq | NM_007400 |
| Protein Refseq | NP_031426 |
| UniProt ID | Q61824 |
| ◆ Recombinant Proteins | ||
| RFL-35134HF | Recombinant Full Length Human Disintegrin And Metalloproteinase Domain-Containing Protein 12(Adam12) Protein, His-Tagged | +Inquiry |
| ADAM12-2179H | Active Recombinant Human ADAM12 protein, His-tagged | +Inquiry |
| ADAM12-74H | Recombinant Human ADAM12 Protein, His-tagged | +Inquiry |
| ADAM12-2594M | Recombinant Mouse ADAM12 Protein (206-706 aa), His-Myc-tagged | +Inquiry |
| ADAM12-233H | Active Recombinant Human ADAM12, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CPBT-676RH | Rabbit Anti-Human ADAM Metallopeptidase Domain 12 Polyclonal Antibody | +Inquiry |
| ADAM12-2592HCL | Recombinant Human ADAM12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAM12 Products
Required fields are marked with *
My Review for All ADAM12 Products
Required fields are marked with *



